DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and CG5550

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster


Alignment Length:242 Identity:77/242 - (31%)
Similarity:112/242 - (46%) Gaps:35/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 KVDFYQPAKSDCHELDEGVRVDGVYRFLVPERNEVQR-----DLYERYCAFATDGPAWTVIQSRG 203
            |:..|:...|.|.||:             |:::.||:     |:.|.||.....|..|.|:|.| 
  Fly    28 KIQTYKKYSSSCKELN-------------PKKSGVQKIQVGSDVIEVYCDVTIAGKGWLVVQRR- 78

  Fly   204 GSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQE-AGEPLDWAEYPLF 267
              ....|||.|:|..|:.|||:|..:|:.|....:||......||.|||.: |||. .:|.|.:|
  Fly    79 --VSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEK-RYAHYSVF 140

  Fly   268 WLDSESYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQ 332
            .:.:...||.::..|.:.|:..|:|..|....|||:||..:   :|...|...|.|.||:..|..
  Fly   141 HVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDND---NATINCAARYMGAWWYRECLS 202

  Fly   333 ---C-NLNGEHGVHQRASPA-----IIWMNWRTGTDKPKSSRMMIRP 370
               | ||||.:.......||     |:|..|:..|...|:..:|:||
  Fly   203 RIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 75/236 (32%)
CG5550NP_001246376.1 FReD 34..250 CDD:238040 75/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446494
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.