DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Angptl4

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_954546.1 Gene:Angptl4 / 362850 RGDID:735058 Length:405 Species:Rattus norvegicus


Alignment Length:393 Identity:109/393 - (27%)
Similarity:162/393 - (41%) Gaps:90/393 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSTGSLNR----IGNSDIGFKSLEELVLIRKTLAAQALKLRGLEINLHRVLSKVVLLADAVVQVP 78
            |..|:|.|    .||:..|.|..:....:.:..|.:.  |:.|:..|....||:..|...|.| .
  Rat    64 GQLGALERRMAACGNACQGPKGTDPKDRVPEGQAPET--LQSLQTQLKAQNSKIQQLFQKVAQ-Q 125

  Fly    79 GRYSSKEDPLAVLSERLNLLLERLNQEERISTNLLELKEWSTKVCQEPSPSQTLPK-----ELTE 138
            .||.||:          ||.::.|..:    .:||........| .:.|..:.|||     .||.
  Rat   126 QRYLSKQ----------NLRIQNLQSQ----IDLLTPTHLDNGV-DKTSRGKRLPKMAQLIGLTP 175

  Fly   139 EKDEPKVDFYQPAKSDCHEL-DEGVRVDGVYR--------FLVPERNEVQRDLYERYCAFATDGP 194
            ....    .::|.: ||.|| .||.|..|:::        |||             .|...:|| 
  Rat   176 NATR----LHRPPR-DCQELFQEGERHSGLFQIQPLGSPPFLV-------------NCEMTSDG- 221

  Fly   195 AWTVIQSR-GGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEP 258
            .|||||.| .||.|    ||:||:.|:.|||:...:||.|.|..|.|......:|.::||     
  Rat   222 GWTVIQRRLNGSVD----FNQSWEAYKDGFGDPQGEFWLGLEKMHSITGDRGSQLAVQLQ----- 277

  Fly   259 LDW------AEYPLFWLDSESYNYQLSVAGEFRGSL------PDALEQHNRMDFSTYDRRRNHAK 311
             ||      .::|:. |..|...|.|.:.......|      |:.|.    :.|||:|  ::|..
  Rat   278 -DWDGNAKLLQFPIH-LGGEDTAYSLQLTEPTANELGATNVSPNGLS----LPFSTWD--QDHDL 334

  Fly   312 SADSTCGEDYGGGWWFDRCTQCNLNGE--HGV---HQRASPAIIWMNWRTGTDKPKSSRMMIRPV 371
            ..|..|.:...|||||..|:..||||:  |.:   .|:....|.|..|:......:::.::|:|:
  Rat   335 RGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQQRKKGIFWKTWKGRYYPLQATTLLIQPM 399

  Fly   372 NPT 374
            ..|
  Rat   400 EAT 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 74/247 (30%)
Angptl4NP_954546.1 FReD 182..399 CDD:238040 74/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.960

Return to query results.
Submit another query.