DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and TNC

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_016870167.1 Gene:TNC / 3371 HGNCID:5318 Length:2384 Species:Homo sapiens


Alignment Length:224 Identity:67/224 - (29%)
Similarity:108/224 - (48%) Gaps:13/224 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PAKSDCHE-LDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENFN 213
            |...||.: :..|....|:|...:   |..:.:..|.:|...:||..|.|...|...   .|||.
Human  2162 PFPKDCSQAMLNGDTTSGLYTIYL---NGDKAEALEVFCDMTSDGGGWIVFLRRKNG---RENFY 2220

  Fly   214 RSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQL 278
            ::|..|.||||:...:||.|.:..:||..:..:|||::|::.||.. :|.|..|.:......|:|
Human  2221 QNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETA-FAVYDKFSVGDAKTRYKL 2284

  Fly   279 SVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEHGVHQ 343
            .|.| :.|:..|::..||...|||:|:   ...||.:.|...|.|.:|:..|.:.||.|.:|.:.
Human  2285 KVEG-YSGTAGDSMAYHNGRSFSTFDK---DTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNN 2345

  Fly   344 RASPAIIWMNWRTGTDKPKSSRMMIRPVN 372
            . |..:.|.:|:......:.:.|.:||.|
Human  2346 H-SQGVNWFHWKGHEHSIQFAEMKLRPSN 2373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 65/221 (29%)
TNCXP_016870167.1 EGF_2 377..403 CDD:285248
EGF_2 408..434 CDD:285248
EGF_2 468..496 CDD:285248
EGF_2 504..527 CDD:285248
EGF_2 533..558 CDD:285248
fn3 624..695 CDD:306538
fn3 713..793 CDD:306538
fn3 804..884 CDD:306538
fn3 894..976 CDD:306538
fn3 986..1064 CDD:306538
fn3 1075..1154 CDD:306538
fn3 1169..1241 CDD:306538
fn3 1260..1327 CDD:306538
fn3 1348..1427 CDD:306538
fn3 1439..1508 CDD:306538
fn3 1533..1605 CDD:306538
fn3 1619..1691 CDD:306538
fn3 1716..1788 CDD:306538
fn3 1804..1883 CDD:306538
fn3 1894..1973 CDD:306538
fn3 1985..2055 CDD:306538
fn3 2071..2143 CDD:306538
Fibrinogen_C 2163..2372 CDD:278572 64/220 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.