DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Tnn

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001100659.2 Gene:Tnn / 304913 RGDID:1306002 Length:1562 Species:Rattus norvegicus


Alignment Length:310 Identity:89/310 - (28%)
Similarity:132/310 - (42%) Gaps:46/310 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 QVPGRYSSKEDPLAVLSERLNLLLERLNQEERISTNLLELKEWSTKVCQEPSPSQTLPKELTEEK 140
            |:.|...:.:.|..:|.|   :.|:|..|.       .||::....|        |.|..|...|
  Rat  1261 QIDGYILTYQLPNGILKE---VELQRGQQR-------FELQDLEQGV--------TYPVSLVAFK 1307

  Fly   141 DEPK----------VDFYQPAKSDCHELDEGVR--VDGVYRFLVPERNEVQRDLYERYCAFATDG 193
            ...:          ||...|..|||.::.:...  ..|:|...:  ..:..|.: :.||...|||
  Rat  1308 GNQRSRSVSTTLSTVDARFPHPSDCSQVQQNTNAAASGLYTIYL--NGDASRPM-QVYCDMDTDG 1369

  Fly   194 PAWTVIQSRG-GSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKIL--YRDDHELRIELQEA 255
            ..|.|.|.|. |..|    |.:.|..|..|||:..::||.|.:..|.:.  ....:|:|.:||.|
  Rat  1370 GGWIVFQRRNTGQLD----FFKRWRSYVEGFGDPMKEFWLGLDKLHNLTTGTTTRYEVRADLQTA 1430

  Fly   256 GEPLDWAEYPLFWLDSESYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGED 320
            .|.. :|.|..|.:.|....|:||| |::||:..|||..||...|:|:||..:.|.   |.|...
  Rat  1431 NESA-YAVYDFFQVASSKERYKLSV-GKYRGTAGDALTYHNGWKFTTFDRDNDIAL---SNCALT 1490

  Fly   321 YGGGWWFDRCTQCNLNGEHGVHQRASPAIIWMNWRTGTDKPKSSRMMIRP 370
            :.||||:..|...|.||::| ..:.|..:.|..|:..........:.|||
  Rat  1491 HHGGWWYKNCHLANPNGKYG-ETKHSEGVNWEPWKGHEFSIPYVELKIRP 1539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 72/226 (32%)
TnnNP_001100659.2 EGF_2 <142..166 CDD:285248
EGF_2 169..197 CDD:285248
EB 181..233 CDD:279949
EGF_2 233..259 CDD:285248
fn3 264..332 CDD:278470
fn3 359..434 CDD:278470
fn3 444..521 CDD:278470
FN3 532..608 CDD:214495
FN3 620..696 CDD:214495
fn3 708..785 CDD:278470
fn3 796..875 CDD:278470
fn3 884..961 CDD:278470
fn3 972..1049 CDD:278470
FN3 1060..1136 CDD:214495
FN3 1148..1224 CDD:214495
fn3 1236..1313 CDD:278470 15/69 (22%)
FReD 1327..1540 CDD:238040 72/226 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.