DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and ANGPT2

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001138.1 Gene:ANGPT2 / 285 HGNCID:485 Length:496 Species:Homo sapiens


Alignment Length:374 Identity:111/374 - (29%)
Similarity:166/374 - (44%) Gaps:74/374 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELVLIRKTLAAQALKLRGL----EIN----LHRVLSKVVLLAD--AVVQVPGRYSSKEDPLAVLS 92
            ||.|:..:|:...|:.:.|    |||    .:..|.|.||..:  .::|:.. ...::|.|.||.
Human   157 ELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQS-IKEEKDQLQVLV 220

  Fly    93 ERLNLLLERLNQEERISTNLL----------ELKEWSTKVCQEPSPSQTLPKELTEEKDEPKVDF 147
            .:.|.::|.|  |::|.|..:          :|.|....:....|.|.: .|:.|..|:| ::.|
Human   221 SKQNSIIEEL--EKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNS-AKDPTVAKEE-QISF 281

  Fly   148 YQPAKSDCHEL-DEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSR-GGSFDPHE 210
                 .||.|: ..|...:|:|....|...|.    .:.||.....|..||:||.| .||.|   
Human   282 -----RDCAEVFKSGHTTNGIYTLTFPNSTEE----IKAYCDMEAGGGGWTIIQRREDGSVD--- 334

  Fly   211 NFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDW------AEYPLFWL 269
             |.|:|.||:.||||.|.::|.||||..::..:..:.|:|.|:      ||      :.|..|:|
Human   335 -FQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLK------DWEGNEAYSLYEHFYL 392

  Fly   270 DSESYNYQLSVAG--EFRGSLPDALEQHNRMDFSTYDRRRNHAKSADS-----TCGEDYGGGWWF 327
            .||..||::.:.|  ...|.:....:..|  ||||        |..|:     .|.:...|||||
Human   393 SSEELNYRIHLKGLTGTAGKISSISQPGN--DFST--------KDGDNDKCICKCSQMLTGGWWF 447

  Fly   328 DRCTQCNLNGEHGVHQRASP----AIIWMNWRTGTDKPKSSRMMIRPVN 372
            |.|...||||.: ..||.:.    .|.|..|:......|::.|||||.:
Human   448 DACGPSNLNGMY-YPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPAD 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 77/239 (32%)
ANGPT2NP_001138.1 SMC_N <78..>295 CDD:330553 37/147 (25%)
FBG 280..494 CDD:214548 78/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.