DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Angptl2

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_036053.2 Gene:Angptl2 / 26360 MGIID:1347002 Length:493 Species:Mus musculus


Alignment Length:378 Identity:104/378 - (27%)
Similarity:163/378 - (43%) Gaps:78/378 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LIRKTLAAQALKLRGLEINLHRVLSKVVLLADAVVQVPGRYSSKE---DPLAVLSERLNLLLERL 102
            :|||  ...||:|..||   :|:|::.   || ::|:..:|...|   ..||:|:...:.::.:|
Mouse   145 IIRK--RDNALELSQLE---NRILNQT---AD-MLQLASKYKDLEHKFQHLAMLAHNQSEVIAQL 200

  Fly   103 NQE-------------------------------ERISTNLLELKEWSTKVCQEPSPSQTLPKEL 136
            .:.                               .:||||.:: .:.:.||.....|:......|
Mouse   201 EEHCQRVPAARPMPQPPPAAPPRVYQPPTYNRIINQISTNEIQ-SDQNLKVLPPSLPTMPALTSL 264

  Fly   137 TEEKDEPKVDFYQPAKSDC-HELDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQ 200
            ....|:|...:     .|| ..|::|.....:|  ||...|  ...|.:.:|....|...|||||
Mouse   265 PSSTDKPSGPW-----RDCLQALEDGHSTSSIY--LVKPEN--TNRLMQVWCDQRHDPGGWTVIQ 320

  Fly   201 SRGGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDW---- 261
            .|   .|...||.|:|:.|:.||||:..::|.|.|..:.:..:.:::|.:.::      ||    
Mouse   321 RR---LDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTME------DWSGRK 376

  Fly   262 --AEYPLFWLDSESYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGG 324
              |||..|.|:.||..|:|.: |.:.|:..|:...||...|:|.||..:   .....|.....||
Mouse   377 VFAEYASFRLEPESEYYKLRL-GRYHGNAGDSFTWHNGKQFTTLDRDHD---VYTGNCAHYQKGG 437

  Fly   325 WWFDRCTQCNLNG--EHGVHQRA--SPAIIWMNWRTGTDKPKSSRMMIRPVNP 373
            ||::.|...||||  ..|.|.|:  ...:.|..:|.|:...|...||||| ||
Mouse   438 WWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRP-NP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 72/231 (31%)
Angptl2NP_036053.2 t_SNARE 156..>206 CDD:197699 13/56 (23%)
FReD 273..487 CDD:238040 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.