DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and ANGPTL5

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_835228.2 Gene:ANGPTL5 / 253935 HGNCID:19705 Length:388 Species:Homo sapiens


Alignment Length:312 Identity:85/312 - (27%)
Similarity:130/312 - (41%) Gaps:59/312 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LLERLNQEERISTNLL--ELKEWSTKVCQEPSPSQTLPKELTEEKDEPKVDFY--QPAKS---DC 155
            ||..:..|::.|.:.|  ::.|...:|..           ||.|....::|.:  :|.:|   ||
Human    97 LLRNMMDEQQASLDYLSNQVNELMNRVLL-----------LTTEVFRKQLDPFPHRPVQSHGLDC 150

  Fly   156 HELDEGV-----RVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENFNRS 215
            .::.:.:     ...|:| .:.||.:...   :|..|.....|...||||.|   .|...:|.|.
Human   151 TDIKDTIGSVTKTPSGLY-IIHPEGSSYP---FEVMCDMDYRGGGRTVIQKR---IDGIIDFQRL 208

  Fly   216 WDEYRAGFGNLSRDFWFGNEFAHKILY-----RDDHELRIELQEAGEPLDWAEYPLFWLDSESYN 275
            |.:|..|||:|..:||.|   ..||.|     .....|.:.|:...:.|.:|.|..|||:.|:..
Human   209 WCDYLDGFGDLLGEFWLG---LKKIFYIVNQKNTSFMLYVALESEDDTLAYASYDNFWLEDETRF 270

  Fly   276 YQLSVAGEFRGSLPDAL------EQHNRMDFSTYDRRRNHAKSADSTCGEDYGG--------GWW 326
            :::.: |.:.|:..||.      :..|.|.|||.|...:..:.|....|:....        |||
Human   271 FKMHL-GRYSGNAGDAFRGLKKEDNQNAMPFSTSDVDNDGCRPACLVNGQSVKSCSHLHNKTGWW 334

  Fly   327 FDRCTQCNLNGEHGVHQR-ASPAIIWMNWRTGTDKP---KSSRMMIRPV-NP 373
            |:.|...||||.|....: .:..|.|..| |..:.|   ||..|.||.: ||
Human   335 FNECGLANLNGIHHFSGKLLATGIQWGTW-TKNNSPVKIKSVSMKIRRMYNP 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 72/251 (29%)
ANGPTL5NP_835228.2 FReD 146..382 CDD:238040 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.