DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Fgg

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006232587.1 Gene:Fgg / 24367 RGDID:2613 Length:445 Species:Rattus norvegicus


Alignment Length:448 Identity:113/448 - (25%)
Similarity:179/448 - (39%) Gaps:109/448 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKFSL---LFLLAWSCVFLGSTGSL-------------NRIG-------------NS-----DIG 32
            |.:||   .|:|.|:.:.|..||..             .|.|             ||     |..
  Rat     1 MNWSLQLRSFILCWALLLLSPTGLAQYTATRDNCCILDERFGSYCPTTCGISDFLNSYQTDVDTD 65

  Fly    33 FKSLEELVL---IRKTLAAQALKLRGLEIN---------LHRVLSKVVLLADAVVQVPGRYSSKE 85
            .::||.::.   .|.|.|.:.:|...:..|         :.....|...:.:.:::......:.|
  Rat    66 LQTLENILQRAENRTTEAKELIKAIQVYYNPDQPPKPGMIEGATQKSKKMVEEILKYEALLLTHE 130

  Fly    86 DPLAVLSERLNLLLERLNQEERISTNLLELKEWSTKVCQEPSPSQTLPKELTEEKDEPKVDFYQP 150
            ..:..|.:...      :.:::| |||.:........||||.            ||..::  :..
  Rat   131 SSIRYLQDIYT------SNKQKI-TNLKQKVAQLEAQCQEPC------------KDSVRI--HDT 174

  Fly   151 AKSDCHEL-DEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSR-GGSFDPHENFN 213
            ...||.:: ::|.:..|:| |:.|.:...|   :..||.....|..|||:|.| .||.|    |.
  Rat   175 TGKDCQDIANKGAKESGLY-FIRPLKATQQ---FLVYCEIDGSGNGWTVLQKRLDGSVD----FK 231

  Fly   214 RSWDEYRAGFGNLS----RDFWFGNEFAHKILYRD--DHELRIELQEAGEPLDWAEYPLFWLDSE 272
            ::|.:|:.|||:||    .:||.|||..|.|..:.  .:.|||:|::.......|:|.:|.:..|
  Rat   232 KNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISMQSTIPYALRIQLKDWSGRTSTADYAMFRVGPE 296

  Fly   273 SYNYQLSVAGEFRGSLPDALE--------------QHNRMDFSTYDRRRNHAKSADSTCGEDYGG 323
            |..|:|:.|....|...||.:              .||.|.|||:|   |.....:..|.|..|.
  Rat   297 SDKYRLTYAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMHFSTWD---NDNDKFEGNCAEQDGS 358

  Fly   324 GWWFDRCTQCNLNG---EHGVHQRASP------AIIWMNWRTGTDKPKSSRMMIRPVN 372
            |||.::|...:|||   :.|.:.::|.      .|||..|:|.....|.:.|.|.|.|
  Rat   359 GWWMNKCHAGHLNGVYYQGGTYSKSSTPNGYDNGIIWATWKTRWYSMKETTMKIIPFN 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 77/251 (31%)
FggXP_006232587.1 Fib_alpha 31..172 CDD:400857 25/161 (16%)
Fibrinogen_C 175..414 CDD:395095 77/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.