DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and FGL1

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_004458.3 Gene:FGL1 / 2267 HGNCID:3695 Length:312 Species:Homo sapiens


Alignment Length:306 Identity:95/306 - (31%)
Similarity:146/306 - (47%) Gaps:58/306 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LERLNQEE---RISTNLLELKEWSTKVCQEPSPSQTLPKELTEEKDEPKVDFYQPAK-------- 152
            ||...||:   |....|||     |:|.|:    |...|:|.:|.:   |.|.....        
Human    23 LEDCAQEQMRLRAQVRLLE-----TRVKQQ----QVKIKQLLQENE---VQFLDKGDENTVIDLG 75

  Fly   153 -----SDCHEL-DEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHEN 211
                 :||.|: ::|.::.|.|: :.|.::..:   :..||.. :||..|||||.|.   |..||
Human    76 SKRQYADCSEIFNDGYKLSGFYK-IKPLQSPAE---FSVYCDM-SDGGGWTVIQRRS---DGSEN 132

  Fly   212 FNRSWDEYRAGFGNLSR---DFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSES 273
            |||.|.:|..||||..:   ::|.||:..|.:..::|:.|:|:|.:..:...:|:|..|.:..|.
Human   133 FNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEK 197

  Fly   274 YNYQLSVAGEFRGSLPDAL-----------EQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWF 327
            ..|:|:: ||:.|:..|:|           ..|.||.|||:||..:   :.:..|.|:...||||
Human   198 NFYELNI-GEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHD---NYEGNCAEEDQSGWWF 258

  Fly   328 DRCTQCNLNGEH--GVH-QRASPAIIWMNWRTGTDKPKSSRMMIRP 370
            :||...||||.:  |.: .:....|:|..|.......||..|.|||
Human   259 NRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 78/252 (31%)
FGL1NP_004458.3 FReD 78..304 CDD:238040 76/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.