DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and FCN2

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_004099.2 Gene:FCN2 / 2220 HGNCID:3624 Length:313 Species:Homo sapiens


Alignment Length:253 Identity:76/253 - (30%)
Similarity:109/253 - (43%) Gaps:41/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 EPSPSQTLPKELTEEKDEPKVDFYQPAKSDCHE-LDEGVRVDGVYRFLVPERNEVQRDLYERYCA 188
            ||.|..|.|:                   .|.: ||.|..:.|.:...:|:...:     ...|.
Human    94 EPQPCLTGPR-------------------TCKDLLDRGHFLSGWHTIYLPDCRPL-----TVLCD 134

  Fly   189 FATDGPAWTVIQSR-GGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIEL 252
            ..|||..|||.|.| .||.|    |.|.|..|:.|||:...:||.||:..|.:..:...|||::|
Human   135 MDTDGGGWTVFQRRVDGSVD----FYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDL 195

  Fly   253 QEAGEPLDWAEYPLFWLDSESYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTC 317
            .:..:...:|:|..|.:..|:..|.|.:.....||..|:|..||...|||.| :.|...:.:  |
Human   196 VDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKD-QDNDLNTGN--C 257

  Fly   318 GEDYGGGWWFDRCTQCNLNGEH--GVHQRASPAIIWMNWRTGTD---KPKSSRMMIRP 370
            ...:.|.||:..|...||||.:  |.|...:..|   ||::|..   ..|.|.|.:||
Human   258 AVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGI---NWKSGKGYNYSYKVSEMKVRP 312

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 71/228 (31%)
FCN2NP_004099.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..99 3/4 (75%)
FReD 102..312 CDD:238040 70/243 (29%)