DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Fga

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001104518.1 Gene:Fga / 14161 MGIID:1316726 Length:789 Species:Mus musculus


Alignment Length:321 Identity:91/321 - (28%)
Similarity:152/321 - (47%) Gaps:69/321 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RLNQEERISTNLLE----LKEWSTKVCQEPSPSQTLPKELTEE---KDEPKVDFYQPAKS----- 153
            :.:.:..|.||:.:    :.|:|:.     |.:.|:.|::|:.   .||...:.::..::     
Mouse   485 KTHSDSDILTNIEDPSSHVPEFSSS-----SKTSTVKKQVTKTYKMADEAGSEAHREGETRNTKR 544

  Fly   154 ---------DCHEL----DEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGS 205
                     ||.::    ..|.: :|::....|..::|    :..||...|....|.:||.|   
Mouse   545 GRARARPTRDCDDVLQTQTSGAQ-NGIFSIKPPGSSKV----FSVYCDQETSLGGWLLIQQR--- 601

  Fly   206 FDPHENFNRSWDEYRAGFGNLS----RDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPL 266
            .|...||||:|.:|:.|||:|:    .:||.||::.|.:..|.. .||:||::......:|||. 
Mouse   602 MDGSLNFNRTWQDYKRGFGSLNDKGEGEFWLGNDYLHLLTLRGS-VLRVELEDWAGKEAYAEYH- 664

  Fly   267 FWLDSESYNYQLSVAGEFRGSLPDALEQ-----------HNRMDFSTYDRRRNHAKSADSTCGED 320
            |.:.||:..|.|.|: .:||:..|||.|           |:.|.|||:||   .|...:..|.|.
Mouse   665 FRVGSEAEGYALQVS-SYRGTAGDALVQGSVEEGTEYTSHSNMQFSTFDR---DADQWEENCAEV 725

  Fly   321 YGGGWWFDRCTQCNLNGEH---GVH--QRASP-----AIIWMNWRTGTDKPKSSRMMIRPV 371
            ||||||::.|...||||.:   |.:  :..||     .::|:.:|......::.||.|||:
Mouse   726 YGGGWWYNSCQAANLNGIYYPGGTYDPRNNSPYEIENGVVWVPFRGADYSLRAVRMKIRPL 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 79/263 (30%)
FgaNP_001104518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..420
Fibrinogen_aC 392..457 CDD:288972
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 526..555 2/28 (7%)
FReD 550..786 CDD:238040 79/249 (32%)
Fib_alpha 51..190 CDD:285864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.