DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Fcnb

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006497739.1 Gene:Fcnb / 14134 MGIID:1341158 Length:322 Species:Mus musculus


Alignment Length:134 Identity:45/134 - (33%)
Similarity:65/134 - (48%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 CHE-LDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSR-GGSFDPHENFNRSWD 217
            |.| |.:|..:.|.|...:|:...:     ...|...|||..|||.|.| .||.|    |.|.|.
Mouse   106 CKELLTQGHFLTGWYTIYLPDCRPL-----TVLCDMDTDGGGWTVFQRRLDGSVD----FFRDWT 161

  Fly   218 EYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQLSVAG 282
            .|:.|||:...:||.||:..|.:..:...|||::|.:.....|:|:|..|.:..|:..|:| :.|
Mouse   162 SYKRGFGSQLGEFWLGNDNIHALTTQGTSELRVDLSDFEGKHDFAKYSSFQIQGEAEKYKL-ILG 225

  Fly   283 EFRG 286
            .|.|
Mouse   226 NFLG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 45/134 (34%)
FcnbXP_006497739.1 Collagen 40..95 CDD:189968
FReD 103..>238 CDD:238040 45/134 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.