DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Fcna

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_032021.1 Gene:Fcna / 14133 MGIID:1340905 Length:334 Species:Mus musculus


Alignment Length:228 Identity:77/228 - (33%)
Similarity:111/228 - (48%) Gaps:22/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 QPAKSDCHE-LDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSR-GGSFDPHEN 211
            |.....|.: |..|:.:.|.|...:|:...:     ...|....||..|||.|.| .||.|    
Mouse   120 QRGPRSCKDLLTRGIFLTGWYTIHLPDCRPL-----TVLCDMDVDGGGWTVFQRRVDGSID---- 175

  Fly   212 FNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNY 276
            |.|.||.|:.|||||..:||.||::.|.:....:.|||::||:......:|:|..|.:..|...|
Mouse   176 FFRDWDSYKRGFGNLGTEFWLGNDYLHLLTANGNQELRVDLQDFQGKGSYAKYSSFQVSEEQEKY 240

  Fly   277 QLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEH-- 339
            :|::.....|:..|:|.:||.|.|:|:| :.|.|.|.:  |...:.|.||:..|.|.||||.:  
Mouse   241 KLTLGQFLEGTAGDSLTKHNNMSFTTHD-QDNDANSMN--CAALFHGAWWYHNCHQSNLNGRYLS 302

  Fly   340 GVHQRASPAIIWMNWRTGTD---KPKSSRMMIR 369
            |.|:..:..|   ||.||..   ..|.:.|.||
Mouse   303 GSHESYADGI---NWGTGQGHHYSYKVAEMKIR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 76/227 (33%)
FcnaNP_032021.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..117
Collagen 65..106 CDD:189968
FReD 123..332 CDD:238040 74/223 (33%)
A domain, contributes to trimerization. /evidence=ECO:0000250 123..162 9/43 (21%)
B domain, contributes to trimerization. /evidence=ECO:0000250 163..251 34/91 (37%)
Carbohydrate-binding. /evidence=ECO:0000250|UniProtKB:O00602 290..292 0/1 (0%)
P domain. /evidence=ECO:0000250|UniProtKB:O00602 325..334 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.