DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and angptl3

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_571893.2 Gene:angptl3 / 114421 ZFINID:ZDB-GENE-010817-3 Length:466 Species:Danio rerio


Alignment Length:386 Identity:116/386 - (30%)
Similarity:176/386 - (45%) Gaps:76/386 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EELVLIRKT---LAAQALKLRGLEINLHRVLSKVVLLADAVVQVPGRYSSKEDPLAVLSERLNLL 98
            ||...:::|   |.|...::|.|.:.::   ||:..:.....|:..:....|:.|..||:.: :.
Zfish   100 EEEEKLKETTIFLKANNEEIRNLSLEIN---SKINNILQERSQLHTKVGGLEEKLKGLSQSM-MP 160

  Fly    99 LERLNQ----------EERISTNLL-ELKEWSTKVCQEPSPSQTL---------------PKELT 137
            ||:|.:          :||..|:|| .:||...::..:....::|               |.:|.
Zfish   161 LEQLQEITALKDVIETQERTITDLLRSVKEQHDQLNYQKIKIKSLEDKVNYDTFQDTIEKPMDLN 225

  Fly   138 EEKDEP--------------KVDFYQPAKSDCHEL-DEGVRVDGVYRFLVPERNEVQRDLYERYC 187
            .|..:|              ..||  ||  ||.|: ..|.:..|:|. :.|.::|.    :..||
Zfish   226 PETPDPFRYLTTNSTNGTKDINDF--PA--DCSEVFTRGQKTSGIYP-IKPNQSEP----FYVYC 281

  Fly   188 AFATDGPAWTVIQSR-GGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIE 251
            ....||.| ||||.| .||.|    |::||::|..|||.|.::||.|....|.|..:.::.|.||
Zfish   282 EITPDGAA-TVIQRREDGSVD----FDQSWEKYEHGFGKLEKEFWLGLAKIHSIAQQGEYILHIE 341

  Fly   252 LQEAGEPLDWAEYPLFWLDSESYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDR-RRNHAKSADS 315
            |::..|...:.|| .|.|:..:.:|.|.:| ...|.|.||:..|..|.|||.|| ..||   .:|
Zfish   342 LEDWKEEKRFIEY-TFTLEGPASDYALHLA-PLSGDLSDAMSNHTGMKFSTKDRDNDNH---DES 401

  Fly   316 TCGEDYGGGWWFDRCTQCNLNGEH------GVHQRASPAIIWMNWRTGTDKPKSSRMMIRP 370
            .|..:|.||||||.|...||||.:      ..|||.. .|.|...:..:...||:::.|||
Zfish   402 NCARNYTGGWWFDACGDTNLNGRYAWMRSKARHQRRK-GIYWRPSKGSSYTLKSTKITIRP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 85/230 (37%)
angptl3NP_571893.2 SMC_N <111..>209 CDD:330553 22/101 (22%)
FReD 248..461 CDD:238040 85/232 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.