DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and angpt2b

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_571889.1 Gene:angpt2b / 114408 ZFINID:ZDB-GENE-010817-2 Length:489 Species:Danio rerio


Alignment Length:370 Identity:95/370 - (25%)
Similarity:163/370 - (44%) Gaps:45/370 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SDIGFKSLEELVLIRKTLAAQALKLRGLEINLHRVLSKVVLLADAVVQVPGRYSSKE----DPLA 89
            :|:..:.|.:...:...|...:|....||..|.....:|..|.|....:..|::..|    ..|.
Zfish   138 TDVETQVLNQTSRLEIQLLEYSLSTNRLEKQLLEQTQEVSRLNDKNSYMEQRFADMEAKHSRELQ 202

  Fly    90 VLSERLNLLLERLNQEERI-------------STNLLELKEWS-TKVCQEPSPSQTLPKELTEEK 140
            .:.:....|||.|:::..:             ::.|::.::.| |...|:.....|...:::...
Zfish   203 AIQQEKQQLLELLDRQNELVSLLEGELASSTRNSTLIQRQQASLTDTVQQLLAMVTHCNDISTPV 267

  Fly   141 DEPKVDFYQPAKSDCHEL-DEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGG 204
            |:..:.|     .||.|: ..||..:|:|...:|  |..|:  .:.:|...|.|..|||.|.|  
Zfish   268 DKEMLKF-----RDCAEIFKSGVTENGIYSIHLP--NSTQK--IKVFCDMKTKGGGWTVFQHR-- 321

  Fly   205 SFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWL 269
             :|...:|||.|::|:.|||:.|.:.|.||:..|.:....|:.|::.|::|.|...:::|..|::
Zfish   322 -YDGSVDFNRDWNDYKLGFGDPSGEHWLGNDVIHLLTTTKDYTLQVHLKDAEEHQAYSQYDTFYI 385

  Fly   270 DSESYNYQLSVAGEFRGSLPDALE-QHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQC 333
            |.|...|.|...| |.|:...... .|:...|||.|:..:   .....|.:...|||||:.|...
Zfish   386 DGEDKKYSLHARG-FSGTAGRTSSLTHSGTQFSTKDQDND---QCSCKCAQMATGGWWFEACGPS 446

  Fly   334 NLNGEHGVHQRASPAII------WMNWRTGTDKPKSSRMMIRPVN 372
            |||   |::...:..:|      |..|:..:.....:.||||||:
Zfish   447 NLN---GIYYSGNSNVIRYNSIKWYYWKGPSWMATMTTMMIRPVD 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 69/228 (30%)
angpt2bNP_571889.1 NYD-SP28 164..244 CDD:291438 14/79 (18%)
FReD 274..487 CDD:238040 70/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.