DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Fcnb

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_446086.1 Gene:Fcnb / 114091 RGDID:621222 Length:319 Species:Rattus norvegicus


Alignment Length:218 Identity:68/218 - (31%)
Similarity:101/218 - (46%) Gaps:14/218 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 CHE-LDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENFNRSWDE 218
            |.| |..|..:.|.|...:|:...:     ...|...|||..|||.|.|   .|...:|.|.|..
  Rat   111 CKELLTRGYFLTGWYTIYLPDCRPL-----TVLCDMDTDGGGWTVFQRR---IDGTVDFFRDWTS 167

  Fly   219 YRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQLSVAGE 283
            |:.|||:...:||.||:..|.:..:..:|||::|.:.....|:|:|..|.:..|:..|:|.:...
  Rat   168 YKQGFGSQLGEFWLGNDNIHALTTQGTNELRVDLADFDGNHDFAKYSSFQIQGEAEKYKLILGNF 232

  Fly   284 FRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEH--GVHQRAS 346
            ..|...|:|...|.|.|||.|:..:   ...|.|...|.|.||:..|...||||.:  |:|:..:
  Rat   233 LGGGAGDSLTSQNNMLFSTKDQDND---QGSSNCAVRYHGAWWYSDCHTSNLNGLYLRGLHKSYA 294

  Fly   347 PAIIWMNWRTGTDKPKSSRMMIR 369
            ..:.|.:|:......|.|.|.:|
  Rat   295 NGVNWKSWKGYNYSYKVSEMKVR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 68/218 (31%)
FcnbNP_446086.1 Collagen 45..100 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..106
FReD 108..317 CDD:238040 67/216 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.