DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and Fgb

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_862897.1 Gene:Fgb / 110135 MGIID:99501 Length:481 Species:Mus musculus


Alignment Length:407 Identity:105/407 - (25%)
Similarity:170/407 - (41%) Gaps:104/407 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IRKTLAAQALKLRGLEINLHRVLSKV-----------VLLADAVVQVPGRYSSKEDPLAVLSERL 95
            :::||..|...::.....|:..:..|           .||.|...:...:....|:   |::|..
Mouse   102 LQQTLLNQERPIKSSIAELNNNIQSVSDTSSVTFQYLTLLKDMWKKKQAQVKENEN---VINEYS 163

  Fly    96 NLLL-ERLNQEERISTNL-LELKEWSTKVCQEPSPSQTLPKELTEEKDEPKVDFYQPAKSDCH-- 156
            ::|. :||..:|.::.|: |.|:...:.:....|..|.|..:::.:.:..:.    |....|:  
Mouse   164 SILEDQRLYIDETVNDNIPLNLRVLRSILEDLRSKIQKLESDISAQMEYCRT----PCTVSCNIP 224

  Fly   157 -----ELDEGVRVDGVYRFLVPERNE---VQRDL----YERYCAFATDGPAWTVIQSR-GGSFDP 208
                 |.:|.:|..|       |.:|   :|.|.    |..||...|:...|||||:| .||.| 
Mouse   225 VVSGKECEEIIRKGG-------ETSEMYLIQPDTSIKPYRVYCDMKTENGGWTVIQNRQDGSVD- 281

  Fly   209 HENFNRSWDEYRAGFGNLSR------------DFWFGNEFAHKILYRDDHELRIELQEAGEPLDW 261
               |.|.||.|:.||||::.            ::|.||:...::......||.||::      ||
Mouse   282 ---FGRKWDPYKKGFGNIATNEDAKKYCGLPGEYWLGNDKISQLTRMGPTELLIEME------DW 337

  Fly   262 ------AEYPLFWLDSESYNYQLSVAGEFRGSLPDALEQ--------------HNRMDFSTYDRR 306
                  |.|..|.:.:|:..||:|| .:::|:..:||..              ||.|.||||||.
Mouse   338 KGDKVKAHYGGFTVQNEASKYQVSV-NKYKGTAGNALMDGASQLVGENRTMTIHNGMFFSTYDRD 401

  Fly   307 RNHAKSAD--STCGEDYGGGWWFDRCTQCNLNG-------------EHGVHQRASPAIIWMNWRT 356
            .:...:.|  ..|.::.|||||::||...|.||             :||    ....::||||:.
Mouse   402 NDGWVTTDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGLYSWDMSKHG----TDDGVVWMNWKG 462

  Fly   357 GTDKPKSSRMMIRPVNP 373
            .....:...|.|||..|
Mouse   463 SWYSMRRMSMKIRPFFP 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 82/282 (29%)
FgbNP_862897.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..81
Beta-chain polymerization, binding distal domain of another fibrin. /evidence=ECO:0000250 35..37
Fib_alpha 82..224 CDD:285864 23/128 (18%)
FReD 227..476 CDD:294064 79/270 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.