DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and ANGPTL7

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_066969.1 Gene:ANGPTL7 / 10218 HGNCID:24078 Length:346 Species:Homo sapiens


Alignment Length:398 Identity:111/398 - (27%)
Similarity:170/398 - (42%) Gaps:86/398 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAWSCVFLGSTGSLNRIGNSDIGFKS----LEELVLIRKTLAAQALKLRGLEINLHRVLSKV 67
            |..:.|.|:|:             :.|.|    |::|.. .||.|...||               
Human     6 LSAVTWLCIFI-------------VAFVSHPAWLQKLSK-HKTPAQPQLK--------------- 41

  Fly    68 VLLADAVVQVPGRYSSKEDPLAVLSERLNLLLERLNQEERISTNLLELKEWSTKVCQE---PSPS 129
              .|:...:|      ||  |......|:.||..||:::.        ::|.:.|.|.   .|.|
Human    42 --AANCCEEV------KE--LKAQVANLSSLLSELNKKQE--------RDWVSVVMQVMELESNS 88

  Fly   130 QTLPKELTEEKDE-----PKVDFYQ------------PAKSDCHEL-DEGVRVDGVYRFLVPERN 176
            :.:...||:.:.:     .::|..|            .|..||..| .:..|:.|||:  :|..:
Human    89 KRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYK--LPPDD 151

  Fly   177 EVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKIL 241
            .:.....|.:|...|.|..||:||.|....   .:|.|.|.:|:.|||::..|||.|||..|: |
Human   152 FLGSPELEVFCDMETSGGGWTIIQRRKSGL---VSFYRDWKQYKQGFGSIRGDFWLGNEHIHR-L 212

  Fly   242 YRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQLSVAGEFRGSL-PDALEQHNRMDFSTYDR 305
            .|....||:|:::....|.:|||..|.|.:|..:|:|.: |.:.|:: .|||:.||...|||.|:
Human   213 SRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFL-GNYTGNVGNDALQYHNNTAFSTKDK 276

  Fly   306 RRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEH---GVHQRASPAIIWMNWRTGTDKPKSSRMM 367
            ..::..   ..|.:...||:|::.||..||||.:   |.|.:....|.|..|...|...|...|.
Human   277 DNDNCL---DKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMK 338

  Fly   368 IRPVNPTP 375
            |||.:..|
Human   339 IRPEDFKP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 77/225 (34%)
ANGPTL7NP_066969.1 SMC_N <37..>109 CDD:330553 19/104 (18%)
FReD 129..341 CDD:238040 75/221 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.