DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and si:ch211-157b11.8

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_009300879.1 Gene:si:ch211-157b11.8 / 101884863 ZFINID:ZDB-GENE-131127-436 Length:392 Species:Danio rerio


Alignment Length:374 Identity:105/374 - (28%)
Similarity:154/374 - (41%) Gaps:77/374 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CVFLGSTGSLNRIGNSD--IGFKSLEELVLIRKTLAAQALKLRGLEINLHRVLSKVVLLADAVVQ 76
            |:....:.:::|...||  :.|.:|...||....|...:.:||.:...|..|:.|          
Zfish    76 CMLQHESVAMSRGDGSDSLVAFLALMAAVLTECNLHCHSQRLREMATRLESVVGK---------- 130

  Fly    77 VPGRYSSKEDPLAVLSERLNLLLERLNQEERISTNLLELKEWSTKVCQEPSPSQTLPKELTEEKD 141
                 :.::|        |.|||:.:...:                     |:...|:..|.   
Zfish   131 -----NGEKD--------LLLLLKSITHSK---------------------PNSLKPRTPTV--- 158

  Fly   142 EPKVDFYQPAKSDCHELDE-GVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGS 205
            .|....|   ..||||:.: |::.:|:|..    :.:.::...|..|...:.|..|||.|.|   
Zfish   159 PPSAGLY---PQDCHEIYQLGIKENGIYTI----QPDPKQPALEAVCDMVSAGGGWTVFQRR--- 213

  Fly   206 FDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLD 270
            ||...:|||:|.|||.|||:...:.|.||...:.:.....|.|||.||:..|....|.|..|.:.
Zfish   214 FDGKTDFNRTWQEYRDGFGSPQTEHWLGNAVLYALTANGQHTLRITLQDWHEQTRHANYNNFKVA 278

  Fly   271 SESYNYQLSVAGEFRGSLPDALE-----QHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRC 330
            .|:..::|: |.|:.|...:|..     .|:...|||||  |:|.:.|...|...||.|||||.|
Zfish   279 GENQRFRLT-AREYHGDAGNAFSYSKQYNHDGRAFSTYD--RDHDRYAAGNCARYYGAGWWFDSC 340

  Fly   331 TQCNLNGE--HGVHQRASPAIIWMNW------RTGTDKP-KSSRMMIRP 370
            ...||||.  ||.:...:..|.|..|      |||.... ||..|..||
Zfish   341 LAANLNGRFYHGRYSGITDGIYWGTWYILTEYRTGERYSFKSVEMKTRP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 81/236 (34%)
si:ch211-157b11.8XP_009300879.1 FReD 165..390 CDD:238040 82/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.