DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and angpt2a

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001265754.1 Gene:angpt2a / 101101687 ZFINID:ZDB-GENE-121101-1 Length:488 Species:Danio rerio


Alignment Length:383 Identity:100/383 - (26%)
Similarity:163/383 - (42%) Gaps:92/383 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELVLIRKTLAAQALKLRGL-EIN-LHRVLSKVVLLADAVVQVPGRYSSKEDPLAVLSERLNLLLE 100
            |..|:..:::...|:...| :|| ::::..|...|...:..:.|:.:::.:.|....|.|..|:|
Zfish   149 ERQLLENSISTSKLEKEFLQQINEINKLKEKNSFLEKGIEDMEGKRNTELETLKEEKEELKKLVE 213

  Fly   101 RL-----NQEERIST--------------------NLLE----LKEWSTKVCQEPSPSQTLPKEL 136
            .|     ..|:::|:                    ||::    .::.|.....:.:|.|.:    
Zfish   214 MLAKVIKEMEQQVSSTSSDNTAMKQQQQELTNTVNNLIQTISVTRQGSNSAMMQDNPDQLI---- 274

  Fly   137 TEEKDEPKVDFYQPAKSDCHEL-DEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQ 200
                             ||..: .:|.:..|||...:|.    .:..::.||...|||..|||||
Zfish   275 -----------------DCAVVFKQGNKKSGVYSLTIPG----TKQQFKAYCDMGTDGGGWTVIQ 318

  Fly   201 SRGGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDW---- 261
            .|   |:...:|:::|..|..|||::|.:.|.|||...|:.....|.|||:|      :||    
Zfish   319 KR---FNGLVDFHQTWKNYTMGFGDISGEHWLGNEIISKLTQEKQHTLRIDL------MDWEGNT 374

  Fly   262 --AEYPLFWLDSESYNYQLSVAGEFRGSL--PDALEQHNRMDFSTYDRRRNHAKSADS-----TC 317
              ::|..|.||.|..||::|:.| :.|:.  ..::.|... |||        ||..|:     .|
Zfish   375 AFSKYSQFSLDGEKQNYRISLNG-YSGTAGRTSSMGQTGG-DFS--------AKDLDNDKCVCKC 429

  Fly   318 GEDYGGGWWFDRCTQCNLNG---EHGVHQRASPAIIWMNWRTGTDKPKSSRMMIRPVN 372
            .:...||||||.|...||||   :.|.:......|.|..|:......|::.|||||.|
Zfish   430 SQMLSGGWWFDACGPSNLNGIYYQQGQNTNRFNGIKWYYWKGSAYSLKATTMMIRPAN 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 76/237 (32%)
angpt2aNP_001265754.1 FReD 275..485 CDD:238040 75/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.