DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and angpt1

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002938959.2 Gene:angpt1 / 100492672 XenbaseID:XB-GENE-488130 Length:504 Species:Xenopus tropicalis


Alignment Length:408 Identity:108/408 - (26%)
Similarity:173/408 - (42%) Gaps:89/408 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TGSLNRIGNS-------------DIGFKSLEELVLIRKTLAAQALKLRGLEINLHRVLSKVV--- 68
            |.::..||.|             |:..:.|.:...:...|...:|....||..|.:..:::|   
 Frog   130 TATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTFKLEKQLIQQTNEIVKIQ 194

  Fly    69 ----LLADAVVQVPGRY-------SSKEDPLAVLSERLNLLLERLNQEERISTN----------- 111
                ||.:.:|::..|:       .::::.|..|..|...:::.|.::...:||           
 Frog   195 EKNSLLENKMVEMEERHKDELNTIKTEKESLQNLVSRQIYIIQELEKQLNKATNNNSILQKQQLE 259

  Fly   112 LLELKEWSTKVCQEPSPSQTLPKELTEEKDEPKVDFYQPAKSDCHEL-DEGVRVDGVYRFLVPER 175
            |:|......|:|.:  ...|| |.:.:|:::|        ..||.:| ..|....|||...:...
 Frog   260 LMETVHNLVKLCSK--EGVTL-KNVKKEEEKP--------FRDCSDLFHAGFNKSGVYTIYINNV 313

  Fly   176 NEVQRDLYERYCAFATDGPAWTVIQSR-GGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHK 239
            :|.::    .||...|.|..|||||.| .||.|    |.|.|.:|:.|||:.|.:||.||||...
 Frog   314 SEPKK----VYCNMDTAGGGWTVIQHREDGSVD----FQRGWKDYKVGFGSPSGEFWLGNEFIFA 370

  Fly   240 ILYRDDHELRIELQEAGEPLDW------AEYPLFWLDSESYNYQLSVAGEF-RGSLPDALEQHNR 297
            :..:..:.|||:|      .||      ::|..|.:.:|..||:|.:.|.. ......:|..|. 
 Frog   371 LTSQRQYSLRIDL------TDWEGNHAHSQYDRFHIGNEKQNYRLYLKGHSGTAGKQSSLILHG- 428

  Fly   298 MDFSTYDRRRNHAKSADS-----TCGEDYGGGWWFDRCTQCNLNGEH---GVHQRASPAIIWMNW 354
            .||||        |.||:     .|.....||||||.|...||||.:   |.:......|.|..:
 Frog   429 ADFST--------KDADNDNCMCKCALMLTGGWWFDACGPSNLNGMYYTAGQNHGKLNGIKWHYF 485

  Fly   355 RTGTDKPKSSRMMIRPVN 372
            :..:...:::.|||||::
 Frog   486 KGPSYSLRATTMMIRPLD 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 76/237 (32%)
angpt1XP_002938959.2 Smc <73..298 CDD:224117 34/178 (19%)
FReD 287..502 CDD:238040 77/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.