DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and angptl4

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002938598.2 Gene:angptl4 / 100492339 XenbaseID:XB-GENE-481750 Length:457 Species:Xenopus tropicalis


Alignment Length:378 Identity:116/378 - (30%)
Similarity:173/378 - (45%) Gaps:67/378 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LEELVLIRKTL--AAQALKLRGLEINLHRVL---------SKVVLLADAVVQVPGRYSSKEDPLA 89
            |:||....|.|  .:|.||.:..||:..|.|         :|:.||..:..|   ..|.|||.|:
 Frog   101 LQELEDKDKQLYDVSQGLKGKVQEISKDRQLLEHRLQNMEAKIQLLEPSKRQ---NRSEKEDLLS 162

  Fly    90 ------VLSERLNLLLERLN-QEERISTNLLELKEWSTKVCQEPSPSQT----LPKELTEE---- 139
                  :.|:|::.|||::. |:.::....|::|.....:......:||    |.|.:.:|    
 Frog   163 IQTLMEIQSKRIDELLEKIKLQQYKLDKQNLQIKSLQNTIQSNRLETQTWKMNLKKTVEDEAQSN 227

  Fly   140 --KDEPKVDFYQPAKSDCHELD-EGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQS 201
              .:|.|..|    .||||::. ||.:..|::. :.|...:.    :|.||....|. .|||.|.
 Frog   228 SSTEEGKHVF----PSDCHQIFLEGKKSSGIFS-IQPSGAQP----FEVYCEMTADA-GWTVTQR 282

  Fly   202 R-GGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAE-- 263
            | .||.|    |:|.||.|..|||||:.:||.|.|..|:|..:..:.:.|:||      ||..  
 Frog   283 RTDGSVD----FDRLWDAYTDGFGNLNGEFWLGLEKMHQITQQGQYLIHIDLQ------DWENNV 337

  Fly   264 ---YPLFWLDSESYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGW 325
               ...|.|...:..|.|.:.|...|.|.:||....::.|||.||.::  |.:|..|.:...|||
 Frog   338 QHMEAKFLLAGSNEAYALQLLGPVTGELENALSDFQQLQFSTRDRDQD--KKSDFNCAKHLSGGW 400

  Fly   326 WFDRCTQCNLNGEHGV------HQRASPAIIWMNWRTGTDKPKSSRMMIRPVN 372
            ||..|...||||::.:      |:| ...|.|..|:......||:.:.||||:
 Frog   401 WFSSCGHSNLNGKYFLSVPRARHER-KQGIFWKTWKGRYYPLKSTSIKIRPVD 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 77/233 (33%)
angptl4XP_002938598.2 Smc <55..>234 CDD:224117 35/135 (26%)
FReD 237..451 CDD:238040 78/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.