DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and angpt4.2

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001191044.1 Gene:angpt4.2 / 100491105 XenbaseID:XB-GENE-5875042 Length:263 Species:Xenopus tropicalis


Alignment Length:263 Identity:84/263 - (31%)
Similarity:116/263 - (44%) Gaps:47/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 SQTLPKELTEEKDEPKVDFYQPAKSDCHELDE--GVRVDGVYRFLVPERNEVQRDLYERYCAFAT 191
            |:..|.|             .|...||..:.|  ...|.|:|. :.|......   ::.:|....
 Frog    24 SEVFPTE-------------NPLGYDCSHIWERNNESVSGIYT-IKPLGASTS---FQVFCEMKA 71

  Fly   192 DGPAWTVIQSRGGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDH--ELRIELQE 254
            || .||:||...|  .....|.|:|.||:.||||:|.:.|.|.|..|.:..:|..  ||.|.| |
 Frog    72 DG-GWTLIQRHDG--QDGLLFTRTWAEYKLGFGNISGEHWLGLENMHILTNQDSRASELFISL-E 132

  Fly   255 AGEPLD--WAEYPLFWLDSESYNYQLSVAGEFRGSLPDALEQ-HNRMD---FSTYDR---RRNHA 310
            |.:..|  :|.|..|.:..||..||||| |.:.|:..||... :|..|   |:|.|:   :.|..
 Frog   133 AFDDSDGAFALYSSFIVAPESKLYQLSV-GNYSGNAGDAFRTGNNNQDGNFFTTKDKDNDKCNPC 196

  Fly   311 KSAD---STCGE-DYGGGWWFDRCTQCNLNG-----EHGVHQRASPAIIWMNWRTGTDKPKSSRM 366
            |..|   |:|.. ....||||..|...||||     |:.|...:|  :.|.::| .|:..|.|:|
 Frog   197 KIGDTRFSSCSRYQSSSGWWFSSCGNANLNGQWRPEENNVGWASS--VHWGSYR-ATESLKYSKM 258

  Fly   367 MIR 369
            .:|
 Frog   259 FVR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 81/242 (33%)
angpt4.2NP_001191044.1 FReD 32..261 CDD:238040 80/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.