DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and mfap4.2

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001103320.1 Gene:mfap4.2 / 100126122 ZFINID:ZDB-GENE-071004-112 Length:242 Species:Danio rerio


Alignment Length:211 Identity:59/211 - (27%)
Similarity:99/211 - (46%) Gaps:20/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 DCHEL-DEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGP-----AWTVIQSRGGSFDPHENF 212
            ||.:: ..|..:.|||.........|.     .||...:||.     .|||||.|   .|...||
Zfish    25 DCSDIYKSGETLSGVYTIYPAGETPVW-----VYCQMISDGKDEENGGWTVIQRR---MDGSVNF 81

  Fly   213 NRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQ 277
            .|...:|:.||||:..::|.|.|..:::.......||::|::......:|:|..|.:..|...|:
Zfish    82 YRPGRDYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCECEGYK 146

  Fly   278 LSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEHGVH 342
            |.|:|...|...|:...||.|.|||:|:.::   :.:..|.:::.|.:|:..|...|.||.:..|
Zfish   147 LQVSGFTDGGAGDSASTHNGMKFSTFDKDQD---TYEKNCAKEFLGAFWYSACHNANPNGVYLWH 208

  Fly   343 QRASP---AIIWMNWR 355
            :.::.   .:.|.:|:
Zfish   209 EGSTHNAIGVSWYSWK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 59/211 (28%)
mfap4.2NP_001103320.1 FReD 23..239 CDD:238040 59/211 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.