DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and fga

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002933535.3 Gene:fga / 100038060 XenbaseID:XB-GENE-478771 Length:761 Species:Xenopus tropicalis


Alignment Length:247 Identity:78/247 - (31%)
Similarity:120/247 - (48%) Gaps:44/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 DCHEL----DEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENFNR 214
            ||.::    ..|.: .|:::.    |.|....:...||...|....|.:||.|.   |...||||
 Frog   526 DCDDIRQKHSSGAK-SGIFKI----RPEGSTKVLSVYCDQDTQLGGWILIQQRQ---DGSVNFNR 582

  Fly   215 SWDEYRAGFGNLSR----DFWFGNEFAHKILYRDDHELRIELQE-AGEPLDWAEYPLFWLDSESY 274
            :|.:|:.|||::..    :.|.|||..| :|.:.|..|||||:: :||.: :|||.: .|.||:.
 Frog   583 TWQDYKNGFGSVDAGGKGEVWLGNENIH-LLTQKDTILRIELEDWSGEKV-YAEYNI-QLGSEAE 644

  Fly   275 NYQLSVAGEFRGSLPDAL----------EQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDR 329
            .:.|.|: ::.|:..|||          ..|..|.||||||   .:...:..|.|.||||||::.
 Frog   645 GFTLKVS-QYEGTAGDALIEGSKEDGEYTSHINMKFSTYDR---DSDKWEENCAEMYGGGWWYNN 705

  Fly   330 CTQCNLNGEHGVHQRASP----------AIIWMNWRTGTDKPKSSRMMIRPV 371
            |...||||.:.:..:..|          .::|:.::......|:.||.:|||
 Frog   706 CQASNLNGIYYIGGQYDPRNNFPYEIENGVVWVPFKAADYSLKTVRMKMRPV 757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 76/245 (31%)
fgaXP_002933535.3 Fib_alpha 51..191 CDD:400857
Fibrinogen_aC 299..372 CDD:403400
FReD 523..757 CDD:238040 76/245 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.