DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and fgl1

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_001923586.2 Gene:fgl1 / 100003029 ZFINID:ZDB-GENE-130815-1 Length:307 Species:Danio rerio


Alignment Length:315 Identity:87/315 - (27%)
Similarity:141/315 - (44%) Gaps:54/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EDPLAVLSERLNLLLERLNQEERISTNLLELKEWSTKVCQEPSPSQTLPKELTEEKDEPKVDFYQ 149
            :|.:..|...|..|..|..:::::...|:.:.:...:..:|.|                   ||.
Zfish    24 QDEIERLRVELRSLELRHTKQQQLIHRLMNINQMDDRSLKEGS-------------------FYD 69

  Fly   150 PAKS---DCHELDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHEN 211
            ...:   ||.::.:.......:..:.|.|:..:   ...:|.. |:|..||:.|.|.   |...:
Zfish    70 TGDTQYMDCAQIFKNGSTSSGFYMIKPLRSPTR---VRVFCDM-TEGGGWTLFQRRS---DGSLS 127

  Fly   212 FNRSWDEYRAGFGNL---SRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSES 273
            |:|.|::|:.|||::   :.:||.||:..|.:..:.|:.|||.|::......:|.|..|.:|:|.
Zfish   128 FDRDWNDYKIGFGDMKSANGEFWLGNDNLHYLTSQGDYTLRINLEDFEGTHRFAVYRNFKVDNEE 192

  Fly   274 YNYQLSVAGEFRGSLPDALE-----------QHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWF 327
            .:|||.. |.:.|:..|||.           .|..|.|||.|  |:|.: .|..|.::..|||||
Zfish   193 KHYQLQF-GMYSGTAGDALSGSFHPEVQWWASHQGMKFSTRD--RDHDR-YDRNCAQEDKGGWWF 253

  Fly   328 DRCTQCNLNGEHGVHQRASPA-----IIWMNWRTGTDKPKSSRMMIRPVNPTPGD 377
            :||...||||.:  |:.|..|     |:|..|.......||.:|.|||.|..|.:
Zfish   254 NRCHSANLNGFY--HRGAYSASTDDGIVWYPWHGWWYSLKSVQMKIRPANFEPNE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 74/242 (31%)
fgl1XP_001923586.2 FReD 74..299 CDD:238040 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.