DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9593 and fgl2b

DIOPT Version :9

Sequence 1:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_001341185.5 Gene:fgl2b / 100001116 ZFINID:ZDB-GENE-120709-53 Length:1447 Species:Danio rerio


Alignment Length:415 Identity:117/415 - (28%)
Similarity:178/415 - (42%) Gaps:95/415 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 STGSL---------NRIGNSDIGFKSLEELVLIRKTLAAQALKLRGLEINLHRV--LSKVVLLAD 72
            :|||:         |...::.|.|:|:           ....:|..:::|..||  :.:.||...
Zfish  1064 NTGSVTNAHVEMPKNVSRDTPISFESI-----------GATKELEHIKLNKDRVDEIPEDVLSNP 1117

  Fly    73 AVVQVPGRYSSKEDPLAVLSERLNLLLERLNQEERISTNLLELKEWSTKVCQEPSPSQTLPKELT 137
            ..|.....||.::..:.|:.|.|.      |.||...:.:..|....|   .|...|..:..|:|
Zfish  1118 NTVDTANGYSGEKYAIPVVLETLT------NTEEIKGSKVFSLSPEDT---AEGFKSHAVSDEVT 1173

  Fly   138 E-EKDEPKV-------------DFYQPAKS----------------DCHELDEGVRVDGVYRFLV 172
            | ||.|.|:             ...||:.|                ||.:.....|.:||||...
Zfish  1174 EREKAENKIHSTCLGNCNTTSTPHSQPSTSQTRTPLAPEREKRPAQDCADYITKSRRNGVYRVTP 1238

  Fly   173 PERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFA 237
            ..:|..    :..:|..|:.|..||:||.|   ||...:|||:||||:.|||.|..:||.||:..
Zfish  1239 RPKNTT----FPVFCDMASSGGGWTLIQHR---FDGSTSFNRTWDEYKNGFGKLIGEFWLGNDKI 1296

  Fly   238 HKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQLSVAGEFRGSLPDALE-----QHNR 297
            |.:....:..||||:::.....::|:|..|::.:||..|:||:.| :.|:..:|::     .|::
Zfish  1297 HLLTKAKNMSLRIEIEDFEGIREYAQYDHFYIANESQQYRLSIDG-YSGTAGNAMQFSKKYNHDQ 1360

  Fly   298 MDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEH------GVHQRASPAIIWMNWRT 356
            ..|:|.||..:...|.:  ||..|..|||||.|...||||::      ||..    .|.|..|..
Zfish  1361 KFFTTPDRDNDQYPSGN--CGAYYSSGWWFDACMSANLNGKYYQSKYKGVRN----GIFWGTWHN 1419

  Fly   357 GT---------DKPKSSRMMIRPVN 372
            .|         ...::.||||||.|
Zfish  1420 ITMEYYPTNERQSFRTVRMMIRPTN 1444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9593NP_650493.2 FReD 150..371 CDD:238040 81/256 (32%)
fgl2bXP_001341185.5 FReD 1219..1442 CDD:238040 78/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.