DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp2 and acyp2

DIOPT Version :9

Sequence 1:NP_001262612.1 Gene:Acyp2 / 41910 FlyBaseID:FBgn0038363 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001015794.1 Gene:acyp2 / 548511 XenbaseID:XB-GENE-944874 Length:103 Species:Xenopus tropicalis


Alignment Length:91 Identity:37/91 - (40%)
Similarity:58/91 - (63%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHWLENNRIPN 76
            ::|:|:|||||||.||.:|..||::|||.||..|||.|||.||::.|...:..||.||.....|:
 Frog    13 SVDYEVFGRVQGVCFRMYTEDEARKLGVVGWVKNTRQGTVTGQVQGPEDKVNSMKAWLSRVGSPS 77

  Fly    77 AKVSKAEFSQIQEIEDYTFTSFDIKH 102
            :::.:.:|:..:||....:..|..::
 Frog    78 SRIDRIDFNDEKEITKLQYNGFSTRY 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acyp2NP_001262612.1 Acylphosphatase 12..101 CDD:279097 37/88 (42%)
acyp2NP_001015794.1 Acylphosphatase 14..100 CDD:376373 36/85 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I4926
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - otm48738
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4463
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.