DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp2 and CG18371

DIOPT Version :9

Sequence 1:NP_001262612.1 Gene:Acyp2 / 41910 FlyBaseID:FBgn0038363 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_610923.1 Gene:CG18371 / 36556 FlyBaseID:FBgn0033893 Length:110 Species:Drosophila melanogaster


Alignment Length:96 Identity:45/96 - (46%)
Similarity:61/96 - (63%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AKQIFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHWLEN 71
            |:|||:..||:|||||||..||.|...|....||||.|||.:||||||||..:..:..:|.||.|
  Fly     5 AEQIFSCGFELFGRVQGVCLRKQTRDLATMNQVRGWVMNTDEGTVKGQLEGTLPKVNVLKFWLLN 69

  Fly    72 NRIPNAKVSKAEFSQIQEIEDYTFTSFDIKH 102
            ...|.:.:.:|||:..:||..:.|:.|.|::
  Fly    70 IGSPRSIIERAEFTPTKEITSHNFSRFSIRY 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acyp2NP_001262612.1 Acylphosphatase 12..101 CDD:279097 40/88 (45%)
CG18371NP_610923.1 Acylphosphatase 10..99 CDD:279097 40/88 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471701
Domainoid 1 1.000 47 1.000 Domainoid score I4519
eggNOG 1 0.900 - - E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5343
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D145178at6656
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - otm26072
orthoMCL 1 0.900 - - OOG6_101060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4463
SonicParanoid 1 1.000 - - X1110
1211.740

Return to query results.
Submit another query.