DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp2 and Acyp2

DIOPT Version :9

Sequence 1:NP_001262612.1 Gene:Acyp2 / 41910 FlyBaseID:FBgn0038363 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001162616.1 Gene:Acyp2 / 364224 RGDID:1595836 Length:124 Species:Rattus norvegicus


Alignment Length:99 Identity:37/99 - (37%)
Similarity:63/99 - (63%) Gaps:0/99 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SGVAKQIFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHW 68
            :.:|:.:.::|:|:||.||||.||.:|..|||:.|:.||..||..|||.||::.|...:..||.|
  Rat    26 AAMAEPLKSVDYEVFGTVQGVCFRMYTEGEAKKRGLVGWVKNTSKGTVTGQVQGPEEKVNSMKSW 90

  Fly    69 LENNRIPNAKVSKAEFSQIQEIEDYTFTSFDIKH 102
            |.....|::::.:|:||..:.|....:::|.|::
  Rat    91 LSKVGSPSSRIDRADFSNEKTISKLEYSNFSIRY 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acyp2NP_001262612.1 Acylphosphatase 12..101 CDD:279097 35/88 (40%)
Acyp2NP_001162616.1 Acylphosphatase 35..122 CDD:395576 35/86 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3360
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - otm45650
orthoMCL 1 0.900 - - OOG6_101060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.