DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp2 and CG14022

DIOPT Version :9

Sequence 1:NP_001262612.1 Gene:Acyp2 / 41910 FlyBaseID:FBgn0038363 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001285625.1 Gene:CG14022 / 33763 FlyBaseID:FBgn0031700 Length:101 Species:Drosophila melanogaster


Alignment Length:92 Identity:25/92 - (27%)
Similarity:45/92 - (48%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHWLENNRI 74
            :..||||::|.|||:...|.|.....:.|:.||..|::.||:.|:::.|...:.:|..||.....
  Fly     9 LVTLDFEVYGHVQGLNLTKDTRDRCTKAGITGWVKNSKQGTIVGKMQGPKEEVDKMITWLSTEGS 73

  Fly    75 PNAKVSKAEFSQIQEIEDYTFTSFDIK 101
            |..::.:.|......:....:..|.|:
  Fly    74 PGCQIDRCEVRNQGNLSRLDYKDFAIR 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acyp2NP_001262612.1 Acylphosphatase 12..101 CDD:279097 24/88 (27%)
CG14022NP_001285625.1 Acylphosphatase 12..99 CDD:395576 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I4519
eggNOG 1 0.900 - - E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I457
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D145178at6656
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - otm42435
orthoMCL 1 0.900 - - OOG6_101060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4463
SonicParanoid 1 1.000 - - X1110
1110.810

Return to query results.
Submit another query.