DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp2 and CG10970

DIOPT Version :10

Sequence 1:NP_650491.1 Gene:Acyp2 / 41910 FlyBaseID:FBgn0038363 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_572517.1 Gene:CG10970 / 31830 FlyBaseID:FBgn0030078 Length:103 Species:Drosophila melanogaster


Alignment Length:112 Identity:30/112 - (26%)
Similarity:48/112 - (42%) Gaps:28/112 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SGVAKQIFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLE------------ 56
            :|..::|...|||:.|||....|......:|..||:||:.....:...||:||            
  Fly     2 AGQKEEILCCDFEVRGRVPKDAFELFALVQANALGLRGFIAQVSEEKFKGRLEGEGKVIDAFKKL 66

  Fly    57 --APMMNLMEMKHWLENNRIPNAKVSKAEFSQIQEIEDYTFTSFDIK 101
              |....:..:|.::    |.|.||          |::||:.:|:||
  Fly    67 ILAAADYVQAIKEFI----IKNLKV----------IQEYTYKTFEIK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acyp2NP_650491.1 Acylphosphatase 13..100 CDD:425830 26/100 (26%)
CG10970NP_572517.1 Acylphosphatase 11..98 CDD:444972 26/100 (26%)

Return to query results.
Submit another query.