DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp2 and Acyp1

DIOPT Version :9

Sequence 1:NP_001262612.1 Gene:Acyp2 / 41910 FlyBaseID:FBgn0038363 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_017449587.1 Gene:Acyp1 / 299203 RGDID:1311327 Length:157 Species:Rattus norvegicus


Alignment Length:91 Identity:39/91 - (42%)
Similarity:60/91 - (65%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHWLENNRI 74
            :.::|:||||:||||||||:|..|.|:||:.||..||..|||:|||:.|:..:..|:.|||....
  Rat    65 LVSVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTNRGTVQGQLQGPVSKVRFMQEWLEKRGS 129

  Fly    75 PNAKVSKAEFSQIQEIEDYTFTSFDI 100
            |.:.:.:|.|:..:.|.:..::.|.|
  Rat   130 PKSHIDRANFNNEKIISNLDYSDFQI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acyp2NP_001262612.1 Acylphosphatase 12..101 CDD:279097 39/89 (44%)
Acyp1XP_017449587.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7777
eggNOG 1 0.900 - - E1_KOG3360
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5033
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - otm45650
orthoMCL 1 0.900 - - OOG6_101060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.