DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uros2 and LOC1277887

DIOPT Version :10

Sequence 1:NP_650489.1 Gene:Uros2 / 41908 FlyBaseID:FBgn0038361 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_061517625.1 Gene:LOC1277887 / 1277887 VectorBaseID:AGAMI1_010942 Length:260 Species:Anopheles gambiae


Alignment Length:52 Identity:13/52 - (25%)
Similarity:20/52 - (38%) Gaps:20/52 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 QNASRAEQLWDLFVSSRARSGEIPLVIAARLFDRPINNLDAKTLNTILHDSK 231
            |:|.|.::|.|      .:..|              |..|.||.|.|:.:|:
Mosquito   113 QDADRKKELCD------KKKAE--------------NKGDYKTWNKIIENSE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uros2NP_650489.1 HemD 9..251 CDD:119440 13/52 (25%)
LOC1277887XP_061517625.1 None

Return to query results.
Submit another query.