DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9590 and FAM114A1

DIOPT Version :9

Sequence 1:NP_650488.1 Gene:CG9590 / 41907 FlyBaseID:FBgn0038360 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001362721.1 Gene:FAM114A1 / 92689 HGNCID:25087 Length:563 Species:Homo sapiens


Alignment Length:501 Identity:130/501 - (25%)
Similarity:214/501 - (42%) Gaps:121/501 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VEKEQQPQEKVSSRNDAKGTAENQEKLETPRISAPATASATSSSWGLWG-GKLSSVLTTATEGLG 100
            |..|.:|:.::..:.      :|...:::|      .:....:.||.|| ..|||...|...||.
Human    98 VSLEAEPRSEIPLQE------QNYLAVDSP------PSGGGWAGWGSWGKSLLSSASATVGHGLT 150

  Fly   101 TITTQ---------VNQGL------NQIIGVPDPEELARINVAEKAEKAAKAPPEENVDDEKESS 150
            .:..:         ||.|.      |...|||:      |..|...:..|::||      ...||
Human   151 AVKEKAGATLRIHGVNSGSSEGAQPNTENGVPE------ITDAATDQGPAESPP------TSPSS 203

  Fly   151 AAFGL-----DFVTNLGSKVLNTGLDTLEGIGKKTMTILQDNDPKLMNKRKLLGLEANSPNLSAV 210
            |:.|:     :.|.|.|..||..|||.||.||||||.:|.::||.....:.|:   ..:.:||.:
Human   204 ASRGMLSAITNVVQNTGKSVLTGGLDALEFIGKKTMNVLAESDPGFKRTKTLM---ERTVSLSQM 265

  Fly   211 LLEAKKEADQMEQSLQQLQLKRQKAQLRFEILFENYCGLVHFEALEILSKESRLKLDTLLDAVSG 275
            |.|||::  :.::..|||.::|   ...:.:||:.|.||.|.|||||||.||..|:.:.|.::.|
Human   266 LREAKEK--EKQRLAQQLTMER---TAHYGMLFDEYQGLSHLEALEILSNESESKVQSFLASLDG 325

  Fly   276 NARAELQETINEVKELIELEDLD---------VESEGDYEAEELSERL-----AAT-------IK 319
            .....|:..:..:|::...::|:         :|.:|:..|..|:|.|     |||       :|
Human   326 EKLELLKNDLISIKDIFAAKELENEENQEEQGLEEKGEEFARMLTELLFELHVAATPDKLNKAMK 390

  Fly   320 DAELGIQFD------DIANHWTQSLSWLTSEEATAAD---------------------LEQAYAK 357
            .|...::.|      |:|.         .|||.|..:                     :|:.|..
Human   391 RAHDWVEEDQTVVSVDVAK---------VSEEETKKEEKEEKSQDPQEDKKEEKKTKTIEEVYMS 446

  Fly   358 SIHALSEACALEMCKLHKIAELLL-----VKPHHSTANEVDGVVNLCQQFNGHLQGLSHRFA--- 414
            ||.:|:|..|..:.:|||:|||:|     .||....|..   ::.|.......:..||.:|.   
Human   447 SIESLAEVTARCIEQLHKVAELILHGQEEEKPAQDQAKV---LIKLTTAMCNEVASLSKKFTNSL 508

  Fly   415 AVLSGKSETEESKGRVSTFFSEMLSAVQFIEKAYKLFTPILQMGAV 460
            ..:....:.|.....:|:...|..::..:|:.|::|..|:||:..:
Human   509 TTVGSNKKAEVLNPMISSVLLEGCNSTTYIQDAFQLLLPVLQVSHI 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9590NP_650488.1 DUF719 80..249 CDD:283086 59/189 (31%)
FAM114A1NP_001362721.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..84
DUF719 135..299 CDD:368390 55/183 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..206 15/52 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..436 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144568
Domainoid 1 1.000 68 1.000 Domainoid score I9734
eggNOG 1 0.900 - - E1_2C2HB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4693
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49595
OrthoDB 1 1.010 - - D403298at33208
OrthoFinder 1 1.000 - - FOG0003527
OrthoInspector 1 1.000 - - otm41794
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12842
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.