DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5614 and Cep20

DIOPT Version :10

Sequence 1:NP_650487.1 Gene:CG5614 / 41906 FlyBaseID:FBgn0038359 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_079621.1 Gene:Cep20 / 66086 MGIID:1913336 Length:174 Species:Mus musculus


Alignment Length:108 Identity:29/108 - (26%)
Similarity:52/108 - (48%) Gaps:15/108 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IKSQLEKNGTMAALRSEMHVKILQMIRGQQNKSKVQALTGGSNQSEDHSLVKLINQMIMEFLDWF 84
            :|..|||.|.:..|::.:..::...:...:.          ...|..|..: |||::|.|:|::.
Mouse    11 LKDTLEKRGVLGHLKARIRAEVFNALDDDRE----------PRPSLSHENL-LINELIREYLEFN 64

  Fly    85 GYKHTMETFRMETGENVA--NRREMEQSLHITPESKD--FPLL 123
            .||:|......|:|:.|.  :|:.:.:.|:...||||  .|||
Mouse    65 KYKYTASVLIAESGQPVVPLDRQFLIRELNAFEESKDNSIPLL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5614NP_650487.1 LisH 71..98 CDD:128913 10/26 (38%)
Cep20NP_079621.1 Necessary and sufficient for homooligomerization and localization to centrosomes and pericentriolar satellites. /evidence=ECO:0000250 1..104 26/103 (25%)
LisH_2 43..113 CDD:475244 23/66 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..174
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.