DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5614 and Cep20

DIOPT Version :9

Sequence 1:NP_650487.1 Gene:CG5614 / 41906 FlyBaseID:FBgn0038359 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_079621.1 Gene:Cep20 / 66086 MGIID:1913336 Length:174 Species:Mus musculus


Alignment Length:108 Identity:29/108 - (26%)
Similarity:52/108 - (48%) Gaps:15/108 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IKSQLEKNGTMAALRSEMHVKILQMIRGQQNKSKVQALTGGSNQSEDHSLVKLINQMIMEFLDWF 84
            :|..|||.|.:..|::.:..::...:...:.          ...|..|..: |||::|.|:|::.
Mouse    11 LKDTLEKRGVLGHLKARIRAEVFNALDDDRE----------PRPSLSHENL-LINELIREYLEFN 64

  Fly    85 GYKHTMETFRMETGENVA--NRREMEQSLHITPESKD--FPLL 123
            .||:|......|:|:.|.  :|:.:.:.|:...||||  .|||
Mouse    65 KYKYTASVLIAESGQPVVPLDRQFLIRELNAFEESKDNSIPLL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5614NP_650487.1 FOP_dimer <71..129 CDD:150162 21/57 (37%)
LisH 71..97 CDD:285685 9/25 (36%)
Cep20NP_079621.1 Necessary and sufficient for homooligomerization and localization to centrosomes and pericentriolar satellites. /evidence=ECO:0000250 1..104 26/103 (25%)
FOP_dimer 43..113 CDD:150162 23/66 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..174
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2B269
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104918
Panther 1 1.100 - - LDO PTHR15431
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.860

Return to query results.
Submit another query.