DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5614 and cep20

DIOPT Version :9

Sequence 1:NP_650487.1 Gene:CG5614 / 41906 FlyBaseID:FBgn0038359 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001313424.1 Gene:cep20 / 567944 ZFINID:ZDB-GENE-101124-1 Length:146 Species:Danio rerio


Alignment Length:112 Identity:24/112 - (21%)
Similarity:51/112 - (45%) Gaps:15/112 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IEQNIKSQLEKNGTMAALRSEMHVKILQMIRGQQNKSKVQALTGGSNQSEDHSLVKLINQMIMEF 80
            ::..::..||..|.:..|::.:..::...:....        |.....|.|:   .|||::|.|:
Zfish     7 LKSALRETLEARGVLGQLKARVRAEVFSALDDPN--------TPRPPLSHDN---LLINELIREY 60

  Fly    81 LDWFGYKHTMETFRMETG--ENVANRREMEQSLHITPES--KDFPLL 123
            |::..|::|......|:|  |...:|..:.:.|::..:|  :..|||
Zfish    61 LEFNKYRYTASVLTAESGQPEVPLDRDFLAKELNVAEDSSARSVPLL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5614NP_650487.1 FOP_dimer <71..129 CDD:150162 17/57 (30%)
LisH 71..97 CDD:285685 8/25 (32%)
cep20NP_001313424.1 FOP_dimer 43..113 CDD:150162 19/68 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104918
Panther 1 1.100 - - LDO PTHR15431
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.