DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5614 and Cep20

DIOPT Version :10

Sequence 1:NP_650487.1 Gene:CG5614 / 41906 FlyBaseID:FBgn0038359 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001101731.1 Gene:Cep20 / 360461 RGDID:1305823 Length:174 Species:Rattus norvegicus


Alignment Length:112 Identity:29/112 - (25%)
Similarity:52/112 - (46%) Gaps:23/112 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IKSQLEKNGTMAALRSEMHVKILQMIRGQQNKSKVQALTGGSNQSEDHSLVK----LINQMIMEF 80
            :|..|||.|.:..|::.:..::...:               .:..|...|:.    |||::|.|:
  Rat    11 LKDTLEKRGVLRHLKARIRAEVFNAL---------------DDDREPRPLLSHENLLINELIREY 60

  Fly    81 LDWFGYKHTMETFRMETGENVA--NRREMEQSLHITPESKD--FPLL 123
            |::..||:|......|:|:.|.  :|:.:.:.|:...||||  .|||
  Rat    61 LEFNKYKYTASVLIAESGQPVVPLDRQFLIRELNAFEESKDNSIPLL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5614NP_650487.1 LisH 71..98 CDD:128913 10/30 (33%)
Cep20NP_001101731.1 LisH_2 43..113 CDD:475244 22/65 (34%)

Return to query results.
Submit another query.