DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5623 and CG12516

DIOPT Version :9

Sequence 1:NP_650485.1 Gene:CG5623 / 41904 FlyBaseID:FBgn0038357 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster


Alignment Length:223 Identity:68/223 - (30%)
Similarity:111/223 - (49%) Gaps:15/223 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AWPGARFMCVCKEGDLNTAAYCLAELMHEPFQPFPMATVAVHHSIRDEFIERVRSRFRQLKPHVA 99
            ||.....|.:.::||:|.|.:.|.|.:.:||....:|.:.|..::.:|...||:...:.|...||
  Fly    82 AWNAPCMMVIFEDGDVNCALHHLVESLQDPFALDAVAVILVQEALAEEIENRVKILMKPLDARVA 146

  Fly   100 NHPNFIRA---VNEL--KYGLRPVKYILADVADAPACASPILVTGGVTHLFFPSGPSGCTTLHTF 159
            |||.:.|.   ::||  |..:.|...:|.|       |:||:|. .:.|.|...||:|..|:|.|
  Fly   147 NHPCYKRTLMKIDELRPKTIIGPSDRVLPD-------ATPIMVR-DIPHKFLGDGPTGIITMHIF 203

  Fly   160 SSMREVALIFGKETP-KFDAVYFFDETITGVYILAKLINCVQFF-VNCMDACLMEIMPHYLDHTP 222
            .:..|...|:.||.| ...:|..::|.::.||.:..::|.:..| :||....:..|...:.....
  Fly   204 RTPFEATQIYRKEYPLPIASVSIWNERVSSVYDVIGMMNLLDTFKINCFTVDMEPIKRAFELRKY 268

  Fly   223 MVVYKRGYHYETLELDQQWKIIVFPYST 250
            .....||||||||.::.:.|||::|..|
  Fly   269 SACIHRGYHYETLPINGERKIIIYPVGT 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5623NP_650485.1 DUF1487 35..252 CDD:254173 68/223 (30%)
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 68/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457906
Domainoid 1 1.000 69 1.000 Domainoid score I16590
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.