DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5623 and CG2336

DIOPT Version :9

Sequence 1:NP_650485.1 Gene:CG5623 / 41904 FlyBaseID:FBgn0038357 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster


Alignment Length:283 Identity:78/283 - (27%)
Similarity:129/283 - (45%) Gaps:44/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTHDLVHNLRCNK------------------------RSPKVRHLMKKTRA-------------- 35
            :.:..::||.|||                        :..||..|...:|:              
  Fly    30 IDYGFIYNLVCNKPRDVSVPLILEIETEFKSKDSAPEKPKKVPRLSYHSRSSSMSEDEPEPEVQV 94

  Fly    36 ---WPGARFMCVCKEGDLNTAAYCLAELMHEPFQPFPMATVAVHHSIRDEFIERVRSRFRQLKPH 97
               |...|.|.:|::||:|.|.:.|.|.:|:||....:||:.:..||.:||::|:|.|...|...
  Fly    95 KYQWNSPRLMILCEDGDINCALHYLVESLHDPFACNAVATLFLQESILEEFVDRIRDRLEPLSTD 159

  Fly    98 VANHPNFIRAVNELKYGLRPVKYILADVADAPACASPILVTGGVTHLFFPSGPSGCTTLHTFSSM 162
            ::.||.:|..:..:  |....|.|:.:....|..|||:||. .::|.:...||:|..|||||.:|
  Fly   160 ISGHPVYIMTLERI--GHLQAKRIVGNPKTVPENASPMLVY-DLSHRYLADGPTGVITLHTFRTM 221

  Fly   163 REVALIFGKETPKFDAVYFFDETITGVYILAKLINCVQFFVNCMDACLMEIMPHYLDHTPMVVYK 227
            :|...:..||...|.:|..::|.:...|.|...::.:.|.:||....|.||...::.:.......
  Fly   222 KEAVELQAKEPLNFTSVCIWNEKLAAAYELVARLSPLIFTINCYYVNLNEITLPFVCNFNSAKII 286

  Fly   228 RGYHYETLELDQQWKIIVFPYST 250
            .|||||:|....:.|::|.|..|
  Fly   287 DGYHYESLTFKGKRKVVVHPVGT 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5623NP_650485.1 DUF1487 35..252 CDD:254173 69/233 (30%)
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 69/216 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457900
Domainoid 1 1.000 69 1.000 Domainoid score I16590
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.