DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5623 and CG11634

DIOPT Version :9

Sequence 1:NP_650485.1 Gene:CG5623 / 41904 FlyBaseID:FBgn0038357 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001286129.1 Gene:CG11634 / 35434 FlyBaseID:FBgn0032968 Length:298 Species:Drosophila melanogaster


Alignment Length:256 Identity:85/256 - (33%)
Similarity:130/256 - (50%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTHDLVHNLRCNKRSP----------KVRHLMKKTRAWPGARFMCVCKEGDLNTAAYCLAELMHE 63
            ||:|:|||  ...|||          ..||:.....:.|  :.|.:.:|||:|:|.:.:.|.:|.
  Fly    32 VTYDMVHN--PEGRSPDHSVIEMTSEADRHIGHDVTSSP--QLMIIFEEGDINSALHFIIESVHN 92

  Fly    64 PFQPFPMATVAVHHSIRDEFIERVRSRFRQLKPHVANHPNFIRAVNEL-KYGLRPVKYILADVAD 127
            ||....:|.|.|...||.|.:||:.|:...|...||.||:::.|:.:. ......::..:::|  
  Fly    93 PFASNAVAMVLVEEKIRGEIVERILSKLHPLSKFVAEHPSYLAALEKCHTSNFNIIRACISEV-- 155

  Fly   128 APACASPILVTGGVTHLFFPSGPSGCTTLHTFSSMREVALIFGKETPKFDAVYFFDETITGVYIL 192
            ||..||||.|. ..||....|.|:|..|.|||.:.:|...|...|:..|.:|..::||:||.|.|
  Fly   156 APPMASPIFVC-DCTHDKLGSYPTGVVTFHTFRNNQEAIAISQCESLAFASVSIWNETLTGCYDL 219

  Fly   193 AKLINCVQFFVNCMDACLMEIMPHYLDHTPMVVYKRGYHYETLELDQQWKIIVFPYSTSIL 253
            ...::...||:||.:..|..|:..:......||.:.|:|:|||.:...:|.||||....||
  Fly   220 VAALSSSYFFLNCANVDLSPILKPHKAQKNYVVVENGFHFETLRIYDNFKAIVFPIGGQIL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5623NP_650485.1 DUF1487 35..252 CDD:254173 72/217 (33%)
CG11634NP_001286129.1 DUF1487 64..279 CDD:254173 72/219 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457901
Domainoid 1 1.000 69 1.000 Domainoid score I16590
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.