DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5623 and CG15717

DIOPT Version :9

Sequence 1:NP_650485.1 Gene:CG5623 / 41904 FlyBaseID:FBgn0038357 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster


Alignment Length:245 Identity:64/245 - (26%)
Similarity:116/245 - (47%) Gaps:12/245 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTHDLVHNLRCNKRSPKVRHLMKKTRAWPGARFMCVCKEGDLNTAAYCLAELMHEPFQPFPMATV 73
            :|..:|:.|:...:..|:. |:.....|...:.|.|.::|||::|.:.|.:.:..||....:||:
  Fly    13 ITSYMVNQLQPTAQETKLA-LIPSAPQWRSPQLMVVFEDGDLHSARHQLLQSLQNPFAEGSVATL 76

  Fly    74 AVHHSIRDEFIERVRSRFRQLKPHVANHPNF---IRAVNELKYGLRPVKYILADVADAPACASPI 135
            .:..||.|:|:..|....|.|...|:.||::   :..:.|||     .|.:..:  ...|..||:
  Fly    77 LLQESIADQFVGLVAQDLRPLSQEVSKHPSYTSTLAKIEELK-----AKTVQGE--SLKAGESPV 134

  Fly   136 LVTGGVTHLFFPSGPSGCTTLHTFSSMREVALIFGKETPKFDAVYFFDETITGVYILAKLINCVQ 200
            ||...| |.:..:|.:|..|:|||.:.:|...:..::...:..|..::|.:...|.|...:....
  Fly   135 LVYDCV-HSYLGNGATGVVTVHTFRTAKEAGQLAKRDPLPYGQVSLWNEKLGCAYELIPRLPSDI 198

  Fly   201 FFVNCMDACLMEIMPHYLDHTPMVVYKRGYHYETLELDQQWKIIVFPYST 250
            ..:||.:..|..|...:......|:..:.||||:|.:..:.:|:|||..|
  Fly   199 VAINCFNPDLDPIWESFAADRNDVLLAKNYHYESLVVSGKRRIVVFPVGT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5623NP_650485.1 DUF1487 35..252 CDD:254173 59/219 (27%)
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 59/219 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457904
Domainoid 1 1.000 69 1.000 Domainoid score I16590
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.