DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4520 and AT1G50400

DIOPT Version :9

Sequence 1:NP_001287340.1 Gene:CG4520 / 41902 FlyBaseID:FBgn0038355 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_175457.1 Gene:AT1G50400 / 841462 AraportID:AT1G50400 Length:310 Species:Arabidopsis thaliana


Alignment Length:296 Identity:60/296 - (20%)
Similarity:106/296 - (35%) Gaps:72/296 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PKFYDGIELDYLHRLAPNKYITAAWVLSH--------------------IRPSGFRFGG------ 87
            |:.::|..|||      ||.:...:.|||                    |..:.:.||.      
plant    47 PELFEGFRLDY------NKSLNQKFFLSHSILMGPTEVPNPTPSSEIIKIPTANYDFGAGFIDPK 105

  Fly    88 LYTF-RVQDDTMYTPTIMGDIHPTSLAANLNILYYPFQSLRMEAVLQKAREAAVESQYTIEWTRP 151
            ||.. |:..|.........|     |..|.        |::..|:|....:.: :....|:    
plant   106 LYLIGRITTDGRLNARAKFD-----LTDNF--------SVKANALLTDEEDKS-QGHLVID---- 152

  Fly   152 CDTWTANFYNVRNESGRCTM---SVMRSVSAHWALGGELLLEWNDPQKLTPDLALAARYSHYNYS 213
               :..:.|..:.:.|..::   :.::.|:.|.:||||..  |.. |:|...:..||||......
plant   153 ---YKGSDYRTQLQLGNNSVYAANYIQHVTPHLSLGGEAF--WLG-QQLMSGVGYAARYETDKTV 211

  Fly   214 LAATASRQGLDV-TYWQRIHPHIQMANLLAWNRNTRKTIATICYQWNFWNSAVHGMFDSDASVGF 277
            .:...:..|:.| .|..::...:..|....:|..:|...|::.|......|.:.|..||:..|  
plant   212 ASGQIASTGVAVMNYVHKVSEKLSFATDFIYNYLSRDVTASVGYDLITRQSRLRGKVDSNGVV-- 274

  Fly   278 MWTKYLTHLPLQMGFSVVMNLPTD------RFAFGM 307
              ..||.. .|.:|...:::...|      :|.||:
plant   275 --AAYLEE-QLPIGLRFLLSAEVDHVKKDYKFGFGV 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4520NP_001287340.1 Porin3_Tom40 33..312 CDD:132766 60/296 (20%)
AT1G50400NP_175457.1 Porin3_Tom40 28..308 CDD:132766 60/296 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346842at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.