DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4520 and TOM40

DIOPT Version :9

Sequence 1:NP_001287340.1 Gene:CG4520 / 41902 FlyBaseID:FBgn0038355 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_188634.1 Gene:TOM40 / 821538 AraportID:AT3G20000 Length:309 Species:Arabidopsis thaliana


Alignment Length:332 Identity:63/332 - (18%)
Similarity:114/332 - (34%) Gaps:93/332 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ERVSGHCNKKNPGNVQNLHILA-HRVMPKFYDGIELDYLHRLAPNKYITAAWVLSH--------- 77
            |:|. :.|..:|...:.||..| ..:....::|:..|:      .:.:...:.|||         
plant    21 EKVD-YSNLPSPVPYEELHREALMSLKSDNFEGLRFDF------TRALNQKFSLSHSVMMGPTEV 78

  Fly    78 ----------IRPSGFRFGGLY-------TFRVQDDTMYTPTIMGDIHPTSLAANLNILY----- 120
                      |..:.:.||..|       ..||..|......:..|: ...|....|.|.     
plant    79 PAQSPETTIKIPTAHYEFGANYYDPKLLLIGRVMTDGRLNARLKADL-TDKLVVKANALITNEEH 142

  Fly   121 -------YPFQSLRMEAVLQKAREAAVESQYTIEWTRPCDTWTANFYNVRNESGRCTMSVMRSVS 178
                   :.:......|.||..:.|.:.:.|                             ::||:
plant   143 MSQAMFNFDYMGSDYRAQLQLGQSALIGATY-----------------------------IQSVT 178

  Fly   179 AHWALGGELLLEW-NDPQKLTPDLALAARY-SHYNYSLAATASRQGLDVTYWQRIHPHIQMANLL 241
            .|.:||||:.  | ..|:|  ..:..|||| :....:....||...:.:.|.|:|...:.:|...
plant   179 NHLSLGGEIF--WAGVPRK--SGIGYAARYETDKMVASGQVASTGAVVMNYVQKISDKVSLATDF 239

  Fly   242 AWNRNTRKTIATICYQWNFWNSAVHGMFDSDASVGFMWTKYLTHLPLQMGFSVVMNLPTD----- 301
            .:|..:|...|::.|.:....:.|.|..||:.....:..:.|:     ||.:.:::...|     
plant   240 MYNYFSRDVTASVGYDYMLRQARVRGKIDSNGVASALLEERLS-----MGLNFLLSAELDHKKKD 299

  Fly   302 -RFAFGM 307
             :|.||:
plant   300 YKFGFGL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4520NP_001287340.1 Porin3_Tom40 33..312 CDD:132766 60/322 (19%)
TOM40NP_188634.1 Porin3_Tom40 28..309 CDD:132766 60/324 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346842at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.