DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4520 and Tomm40l

DIOPT Version :9

Sequence 1:NP_001287340.1 Gene:CG4520 / 41902 FlyBaseID:FBgn0038355 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001032247.1 Gene:Tomm40l / 641376 MGIID:3589112 Length:308 Species:Mus musculus


Alignment Length:289 Identity:69/289 - (23%)
Similarity:125/289 - (43%) Gaps:27/289 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NPGNVQNLHILAHRVMPKFYDGIELDYLHRLAPNKYITAAWVLSH-IRPSGFRFGG--LYTFRVQ 94
            |||:...||.|...|.|...:|:      :|..||.:::.:.::| :..|.....|  |:|....
Mouse    26 NPGSFDELHRLCKDVFPAQMEGV------KLVVNKVLSSHFQVAHTVHMSALGLPGYHLHTAYAG 84

  Fly    95 D----DTMYTPTIMGDIHPTSLAANLNILYYPFQSLRMEAVLQKAREAAVESQYTIEWTRPCDTW 155
            |    .|...||::||: .:|.:.|..:|....:.||.:||.|..:...:..|:..|:..  |.:
Mouse    85 DWQLSPTEVFPTVVGDM-DSSGSLNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRG--DDY 146

  Fly   156 TANFY----NVRNESGRCTMSVMRSVSAHWALGGELLLEWNDPQKLTPDLALAARYSHYNYSLAA 216
            ||...    ::..||.......::|::....|||||:.. ..|.:....|.||.:||..::....
Mouse   147 TATLTLGNPDLIGESVIMVAHFLQSITHRLVLGGELVYH-RRPGEEGAILTLAGKYSAVHWVATL 210

  Fly   217 TASRQGLDVTYWQRIHPHIQMANLLAWNRNTRKTIATICYQWNFW----NSAVHGMFDSDASVGF 277
            .....|...:|:.:.:..:|:.  :.:..|||....|..:.::..    :....|:.||:..||.
Mouse   211 NVGSGGAHASYYHKANEQVQVG--VEFEANTRLQDTTFSFGYHLTLPQADMVFRGLVDSNWCVGA 273

  Fly   278 MWTKYLTHLPLQMGFSVVMNLPTDRFAFG 306
            :..|.:..||:.:.....:|...:||..|
Mouse   274 VLEKKMRPLPVTLALGAFLNHWRNRFHCG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4520NP_001287340.1 Porin3_Tom40 33..312 CDD:132766 69/289 (24%)
Tomm40lNP_001032247.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 2/2 (100%)
Porin3_Tom40 24..308 CDD:132766 69/289 (24%)
Required for mitochondrial targeting. /evidence=ECO:0000250 281..308 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.