DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4520 and si:dkey-71l1.1

DIOPT Version :9

Sequence 1:NP_001287340.1 Gene:CG4520 / 41902 FlyBaseID:FBgn0038355 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001107910.1 Gene:si:dkey-71l1.1 / 569883 ZFINID:ZDB-GENE-070705-489 Length:318 Species:Danio rerio


Alignment Length:289 Identity:72/289 - (24%)
Similarity:126/289 - (43%) Gaps:25/289 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NPGNVQNLHILAHRVMPKFYDGIELDYLHRLAPNKYITAAWVLSH------IRPSGFRFGGLYTF 91
            |||:...||.....|.|...:|:      :|..||.:::.:.:||      :.||.:||   :..
Zfish    36 NPGSFDGLHRNCKDVFPHQIEGV------KLVINKTLSSFFKVSHTFHLSAVAPSSYRF---HAE 91

  Fly    92 RVQDDT----MYTPTIMGDIHPTSLAANLNILYYPFQSLRMEAVLQKAREAAVESQYTIEWTRPC 152
            .:|.||    ..:|.::|:: .:|.:.|.:.|::..:.:|.:|:.|..:...|..|:..|:....
Zfish    92 HLQSDTDSKETDSPMLIGEM-DSSGSLNAHSLFHLSEKIRAKAIFQTQQAQFVTWQFETEYRGSD 155

  Fly   153 DTWTANFYN--VRNESGRCTMSVMRSVSAHWALGGELLLEWNDPQKLTPDLALAARYSHYNYSLA 215
            .|......|  |..||.......::|||....|||||:......:: ...|.||.:||..|:...
Zfish   156 FTAAVTMANPDVLRESVIMVAHFLQSVSPQLVLGGELVYHRGRAEE-GGILTLAGQYSGANWIAT 219

  Fly   216 ATASRQGLDVTYWQRIHPHIQMANLLAWNRNTRKTIATICYQWNFWNSAV--HGMFDSDASVGFM 278
            ..|.:.|...:|:.|.:..||:......:..|::|..:..||.....:.:  .||.||...:|.:
Zfish   220 LNAGKGGAHASYYHRANKQIQVGVEFEASTRTQETTFSFGYQMELPEAKMVFRGMLDSRCIIGGV 284

  Fly   279 WTKYLTHLPLQMGFSVVMNLPTDRFAFGM 307
            ..|.|..||..:.....:|...|:...|:
Zfish   285 LEKRLYPLPATLIMGAFVNHRADKLQVGL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4520NP_001287340.1 Porin3_Tom40 33..312 CDD:132766 72/289 (25%)
si:dkey-71l1.1NP_001107910.1 Porin3_Tom40 34..318 CDD:132766 72/289 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346842at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.