DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4520 and Tom40

DIOPT Version :9

Sequence 1:NP_001287340.1 Gene:CG4520 / 41902 FlyBaseID:FBgn0038355 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001259313.1 Gene:Tom40 / 44978 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster


Alignment Length:284 Identity:72/284 - (25%)
Similarity:128/284 - (45%) Gaps:12/284 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KNPGNVQNLHILAHRVMPKFYDGIELDYLHRLAPNKYITAAWVLSHIRPSGFRFGGLYTFRVQ-D 95
            :|||.|:.||.....:....::|.::.....|:.:..::....:|::.|||:|||..|....: .
  Fly    58 ENPGTVEELHKKCKDIQAITFEGAKIMLNKGLSNHFQVSHTINMSNVVPSGYRFGATYVGTKEFS 122

  Fly    96 DTMYTPTIMGDIHPTSLAANL--NILYYPFQSLRMEAVLQKAREAAVESQYTIEWTRPCDTWTAN 158
            .|...|.::|||.|   |.||  |:::.....||.:...|......|.||.|.::.....|.:..
  Fly   123 PTEAFPVLLGDIDP---AGNLNANVIHQFSARLRCKFASQIQESKVVASQLTTDYRGSDYTLSLT 184

  Fly   159 FYN--VRNESGRCTMSVMRSVSAHWALGGELLLEW--NDPQKLTPDLALAARYSHYNYSLAATAS 219
            ..|  :...||......::||:...|||.||..::  |.|.:....:::..||:..:...:.|..
  Fly   185 VANPSIFTNSGVVVGQYLQSVTPALALGSELAYQFGPNVPGRQIAIMSVVGRYTAGSSVWSGTLG 249

  Fly   220 RQGLDVTYWQRIHPHIQMANLLAWNRNTRKTIATICYQWNF--WNSAVHGMFDSDASVGFMWTKY 282
            :.||.|.|:|:....:|:...:..:...::::||:.||.:.  .|....|..||:..:..:..|.
  Fly   250 QSGLHVCYYQKASDQLQIGAEVETSLRMQESVATLAYQIDLPKANLVFRGGIDSNWQIFGVLEKR 314

  Fly   283 LTHLPLQMGFSVVMNLPTDRFAFG 306
            |..||..:..|..||...:.|..|
  Fly   315 LAPLPFTLALSGRMNHVKNNFRLG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4520NP_001287340.1 Porin3_Tom40 33..312 CDD:132766 72/283 (25%)
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 72/284 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463706
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3296
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1946
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346842at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.