DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4520 and tomm40l

DIOPT Version :9

Sequence 1:NP_001287340.1 Gene:CG4520 / 41902 FlyBaseID:FBgn0038355 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_998124.1 Gene:tomm40l / 405895 ZFINID:ZDB-GENE-040426-2319 Length:338 Species:Danio rerio


Alignment Length:284 Identity:71/284 - (25%)
Similarity:117/284 - (41%) Gaps:17/284 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NPGNVQNLHILAHRVMPKFYDGIELDYLHRLAPNKYITAAWVLSHIRPSGFRFGGLYTFRVQDDT 97
            |||..:..|.....|.|...:|:.|.....|:.:..:....:||....|.:|||..|.     .|
Zfish    56 NPGGFEECHRKCKEVFPVQMEGVRLTVNKGLSNHFQVNHTVLLSTQADSSYRFGATYV-----GT 115

  Fly    98 MYT------PTIMGDIHPTSLAANLNILYYPFQSLRMEAVLQKAREAAVESQYTIEWTRPCDTWT 156
            ..|      |.::||:..|. :.|..:::.....:|.:.|.|..::..|..|...|:.....|..
Zfish   116 KQTGPGEAFPVMVGDMDNTG-SLNAQVIHQITDKVRSKFVFQTQQQKFVNWQGDTEFKGEDFTAA 179

  Fly   157 ANFYN--VRNESGRCTMSVMRSVSAHWALGGELLLEWNDPQKLTPDLALAARYSHYNYSLAATAS 219
            ..|.|  |...||......::||::..||||||:......::.|. ::||.||:..|:....|..
Zfish   180 VTFGNPDVLMGSGIVVAHYLQSVTSSLALGGELVYHRRPGEEGTV-MSLAGRYTGSNFIATLTLG 243

  Fly   220 RQGLDVTYWQRIHPHIQMANLLAWNRNTRKTIATICYQWNF--WNSAVHGMFDSDASVGFMWTKY 282
            ..|:..:|:.:.:..:|:......:...:.|..|..||.:.  .|....|..||:..||....|.
Zfish   244 GAGVHASYYHKANDQLQVGVEYEVSTRMQDTSVTFGYQLDVPKANLVFKGSLDSNWVVGANLEKK 308

  Fly   283 LTHLPLQMGFSVVMNLPTDRFAFG 306
            |..|||.:..|..::....:|..|
Zfish   309 LQPLPLSLALSAYLDHRKHKFQCG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4520NP_001287340.1 Porin3_Tom40 33..312 CDD:132766 71/284 (25%)
tomm40lNP_998124.1 Porin3_Tom40 54..338 CDD:132766 71/284 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346842at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.