DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4520 and tomm40

DIOPT Version :9

Sequence 1:NP_001287340.1 Gene:CG4520 / 41902 FlyBaseID:FBgn0038355 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_017206807.1 Gene:tomm40 / 322645 ZFINID:ZDB-GENE-030131-1365 Length:360 Species:Danio rerio


Alignment Length:287 Identity:70/287 - (24%)
Similarity:118/287 - (41%) Gaps:23/287 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NPGNVQNLHILAHRVMPKFYDGIELDYLHRLAPNKYITAAWVLSH------IRPSGFRFGGLYTF 91
            |||..:..|.....|.|...:|:      ||..||.::..:.:||      :..||:|||..|..
Zfish    78 NPGTFEECHRKCKEVFPVQMEGV------RLVVNKGLSNHFQVSHTITLSTLGDSGYRFGSTYVG 136

  Fly    92 RVQDDTMYT-PTIMGDIHPTSLAANLNILYYPFQSLRMEAVLQKAREAAVESQYTIEWTRPCDTW 155
            ..|.....: |.::||:..|. :.|..:::.....:|.:..:|..:...|..|...|:..  |.:
Zfish   137 SKQTGPAESFPVMVGDMDNTG-SLNAQVIHQLTNRVRSKIAIQTQQHKFVNWQCDGEYRG--DDF 198

  Fly   156 TANFY----NVRNESGRCTMSVMRSVSAHWALGGELLLEWNDPQKLTPDLALAARYSHYNYSLAA 216
            ||...    :|...||......::|:|....|||||:......::.|. .:|..||:..||....
Zfish   199 TAAVTLGNPDVLVGSGILVAHYLQSLSPSLVLGGELVYHKRPGEEGTV-TSLVGRYTGSNYVATL 262

  Fly   217 TASRQGLDVTYWQRIHPHIQMANLLAWNRNTRKTIATICYQWNF--WNSAVHGMFDSDASVGFMW 279
            |....|...:|:.:.:..:|:......:...::|..:..||.:.  .|....|..||:..||...
Zfish   263 TVGGAGAHASYYHKANDQLQVGVEFEASTRMQETSVSFGYQLDVPKANLLFKGSLDSNWVVGATL 327

  Fly   280 TKYLTHLPLQMGFSVVMNLPTDRFAFG 306
            .|.|..|||.:.....:|...::|..|
Zfish   328 EKKLLPLPLSLALGAFLNHRKNKFQCG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4520NP_001287340.1 Porin3_Tom40 33..312 CDD:132766 70/287 (24%)
tomm40XP_017206807.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346842at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.