DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4520 and Tomm40

DIOPT Version :9

Sequence 1:NP_001287340.1 Gene:CG4520 / 41902 FlyBaseID:FBgn0038355 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_997685.1 Gene:Tomm40 / 308416 RGDID:1303022 Length:361 Species:Rattus norvegicus


Alignment Length:289 Identity:71/289 - (24%)
Similarity:119/289 - (41%) Gaps:10/289 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GHCN-KKNPGNVQNLHILAHRVMPKFYDGIELDYLHRLAPNKYITAAWVLSHIRPSGFRFGGLYT 90
            |:|. ..|||..:..|.....:.|...:|::|.....|:....:|....|..|..|.:.||..|.
  Rat    72 GNCGCLPNPGTFEECHRKCKELFPVQMEGVKLTVNKGLSNRFQVTHTVALGTIGESNYHFGVTYV 136

  Fly    91 FRVQ-DDTMYTPTIMGDIHPTSLAANLNILYYPFQSLRMEAVLQKAREAAVESQYTIEWTRPCDT 154
            ...| ..|...|.::||: ..|.:.|..:::.....||.:..:|..:...|..|...|:.....|
  Rat   137 GTKQLSPTEAFPVLVGDM-DNSGSLNAQVIHQLSPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFT 200

  Fly   155 WTANFYN--VRNESGRCTMSVMRSVSAHWALGGELLLEWNDPQKLTPDLALAARYSHYNYSLAAT 217
            ......|  |...||......::|::...||||||:......:|.|. ::||.:|:..|:....|
  Rat   201 AAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEKGTV-MSLAGKYTLNNWLATVT 264

  Fly   218 ASRQGLDVTYWQRIHPHIQMANLLAWNRNTRKTIATICYQWNF--WNSAVHGMFDSDASVGFMWT 280
            ..:.|:..||:.:....:|:......:...:.|.|:..||.:.  .|....|..:|:..||....
  Rat   265 LGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSASFGYQLDLPKANFLFKGSVNSNWIVGATLE 329

  Fly   281 KYLTHLPLQMGFSVVMNLPTDRF--AFGM 307
            |.|..|||.:.....:|...::|  .||:
  Rat   330 KKLPPLPLTLSLCAFLNHRKNKFLCGFGL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4520NP_001287340.1 Porin3_Tom40 33..312 CDD:132766 69/282 (24%)
Tomm40NP_997685.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72 71/289 (25%)
Porin3_Tom40 77..361 CDD:132766 69/284 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346842at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.